Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   M8968_RS09890 Genome accession   NZ_CP097594
Coordinates   1914794..1915171 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0182     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1909794..1920171
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8968_RS09855 - 1910105..1911055 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  M8968_RS09860 comGA 1911252..1912322 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M8968_RS09865 comGB 1912309..1913346 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8968_RS09870 comGC 1913351..1913659 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M8968_RS09875 comGD 1913649..1914086 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8968_RS09880 comGE 1914070..1914384 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8968_RS09885 comGF 1914293..1914793 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  M8968_RS09890 comGG 1914794..1915171 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8968_RS09895 - 1915228..1915407 (+) 180 WP_022552966.1 YqzE family protein -
  M8968_RS09900 - 1915448..1915777 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M8968_RS09905 tapA 1916036..1916707 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M8968_RS09910 - 1916679..1917263 (+) 585 WP_032874025.1 signal peptidase I -
  M8968_RS09915 - 1917328..1918113 (+) 786 WP_032874027.1 TasA family protein -
  M8968_RS09920 sinR 1918161..1918496 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8968_RS09925 sinI 1918530..1918703 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  M8968_RS09930 - 1918880..1919674 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=690943 M8968_RS09890 WP_032874019.1 1914794..1915171(+) (comGG) [Bacillus velezensis strain UA0182]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=690943 M8968_RS09890 WP_032874019.1 1914794..1915171(+) (comGG) [Bacillus velezensis strain UA0182]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488