Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8970_RS07285 Genome accession   NZ_CP097590
Coordinates   1574255..1574428 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0195     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1569255..1579428
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8970_RS07270 gcvT 1570069..1571169 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  M8970_RS07275 - 1571592..1573262 (+) 1671 WP_032874031.1 SNF2-related protein -
  M8970_RS07280 - 1573284..1574078 (+) 795 WP_007612541.1 YqhG family protein -
  M8970_RS07285 sinI 1574255..1574428 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  M8970_RS07290 sinR 1574462..1574797 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8970_RS07295 - 1574845..1575630 (-) 786 WP_032874027.1 TasA family protein -
  M8970_RS07300 - 1575695..1576279 (-) 585 WP_032874025.1 signal peptidase I -
  M8970_RS07305 tapA 1576251..1576922 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M8970_RS07310 - 1577181..1577510 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M8970_RS07315 - 1577551..1577730 (-) 180 WP_022552966.1 YqzE family protein -
  M8970_RS07320 comGG 1577787..1578164 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8970_RS07325 comGF 1578165..1578665 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  M8970_RS07330 comGE 1578574..1578888 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8970_RS07335 comGD 1578872..1579309 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=690700 M8970_RS07285 WP_032874029.1 1574255..1574428(+) (sinI) [Bacillus velezensis strain UA0195]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=690700 M8970_RS07285 WP_032874029.1 1574255..1574428(+) (sinI) [Bacillus velezensis strain UA0195]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719