Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   M8970_RS07330 Genome accession   NZ_CP097590
Coordinates   1578574..1578888 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0195     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1573574..1583888
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8970_RS07285 sinI 1574255..1574428 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  M8970_RS07290 sinR 1574462..1574797 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8970_RS07295 - 1574845..1575630 (-) 786 WP_032874027.1 TasA family protein -
  M8970_RS07300 - 1575695..1576279 (-) 585 WP_032874025.1 signal peptidase I -
  M8970_RS07305 tapA 1576251..1576922 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M8970_RS07310 - 1577181..1577510 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M8970_RS07315 - 1577551..1577730 (-) 180 WP_022552966.1 YqzE family protein -
  M8970_RS07320 comGG 1577787..1578164 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8970_RS07325 comGF 1578165..1578665 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  M8970_RS07330 comGE 1578574..1578888 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8970_RS07335 comGD 1578872..1579309 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8970_RS07340 comGC 1579299..1579607 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M8970_RS07345 comGB 1579612..1580649 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8970_RS07350 comGA 1580636..1581706 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M8970_RS07355 - 1581903..1582853 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=690703 M8970_RS07330 WP_032874016.1 1578574..1578888(-) (comGE) [Bacillus velezensis strain UA0195]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=690703 M8970_RS07330 WP_032874016.1 1578574..1578888(-) (comGE) [Bacillus velezensis strain UA0195]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481