Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   M8961_RS12355 Genome accession   NZ_CP097588
Coordinates   2515502..2515939 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0323     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2510502..2520939
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8961_RS12305 sinI 2510886..2511059 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8961_RS12310 sinR 2511093..2511428 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8961_RS12315 - 2511476..2512261 (-) 786 WP_007408329.1 TasA family protein -
  M8961_RS12320 - 2512326..2512910 (-) 585 WP_012117977.1 signal peptidase I -
  M8961_RS12325 tapA 2512882..2513553 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8961_RS12330 - 2513812..2514141 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8961_RS12335 - 2514181..2514360 (-) 180 WP_003153093.1 YqzE family protein -
  M8961_RS12340 comGG 2514417..2514794 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8961_RS12345 comGF 2514795..2515295 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8961_RS12350 comGE 2515204..2515518 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8961_RS12355 comGD 2515502..2515939 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8961_RS12360 comGC 2515929..2516195 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  M8961_RS12365 comGB 2516242..2517279 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8961_RS12370 comGA 2517266..2518336 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  M8961_RS12375 - 2518533..2519483 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  M8961_RS12380 - 2519629..2520930 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=690574 M8961_RS12355 WP_012117983.1 2515502..2515939(-) (comGD) [Bacillus velezensis strain UA0323]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=690574 M8961_RS12355 WP_012117983.1 2515502..2515939(-) (comGD) [Bacillus velezensis strain UA0323]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACGGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572