Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8961_RS12305 Genome accession   NZ_CP097588
Coordinates   2510886..2511059 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain UA0323     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2505886..2516059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8961_RS12290 gcvT 2506699..2507799 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  M8961_RS12295 - 2508223..2509893 (+) 1671 WP_012117975.1 SNF2-related protein -
  M8961_RS12300 - 2509915..2510709 (+) 795 WP_012117976.1 YqhG family protein -
  M8961_RS12305 sinI 2510886..2511059 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8961_RS12310 sinR 2511093..2511428 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8961_RS12315 - 2511476..2512261 (-) 786 WP_007408329.1 TasA family protein -
  M8961_RS12320 - 2512326..2512910 (-) 585 WP_012117977.1 signal peptidase I -
  M8961_RS12325 tapA 2512882..2513553 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8961_RS12330 - 2513812..2514141 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8961_RS12335 - 2514181..2514360 (-) 180 WP_003153093.1 YqzE family protein -
  M8961_RS12340 comGG 2514417..2514794 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8961_RS12345 comGF 2514795..2515295 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8961_RS12350 comGE 2515204..2515518 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8961_RS12355 comGD 2515502..2515939 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=690571 M8961_RS12305 WP_003153105.1 2510886..2511059(+) (sinI) [Bacillus velezensis strain UA0323]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=690571 M8961_RS12305 WP_003153105.1 2510886..2511059(+) (sinI) [Bacillus velezensis strain UA0323]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702