Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8957_RS11400 Genome accession   NZ_CP097587
Coordinates   2369698..2369871 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain UA0276     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2364698..2374871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8957_RS11350 comGD 2364818..2365255 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8957_RS11355 comGE 2365239..2365553 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8957_RS11360 comGF 2365462..2365962 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8957_RS11365 comGG 2365963..2366340 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8957_RS11370 - 2366397..2366576 (+) 180 WP_003153093.1 YqzE family protein -
  M8957_RS11375 - 2366616..2366945 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8957_RS11380 tapA 2367204..2367875 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8957_RS11385 - 2367847..2368431 (+) 585 WP_012117977.1 signal peptidase I -
  M8957_RS11390 - 2368496..2369281 (+) 786 WP_007408329.1 TasA family protein -
  M8957_RS11395 sinR 2369329..2369664 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8957_RS11400 sinI 2369698..2369871 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8957_RS11405 - 2370048..2370842 (-) 795 WP_012117976.1 YqhG family protein -
  M8957_RS11410 - 2370864..2372534 (-) 1671 WP_012117975.1 SNF2-related protein -
  M8957_RS11415 gcvT 2372958..2374058 (+) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=690498 M8957_RS11400 WP_003153105.1 2369698..2369871(-) (sinI) [Bacillus velezensis strain UA0276]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=690498 M8957_RS11400 WP_003153105.1 2369698..2369871(-) (sinI) [Bacillus velezensis strain UA0276]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702