Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   M8957_RS11365 Genome accession   NZ_CP097587
Coordinates   2365963..2366340 (+) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0276     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2360963..2371340
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8957_RS11330 - 2361274..2362224 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  M8957_RS11335 comGA 2362421..2363491 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  M8957_RS11340 comGB 2363478..2364515 (+) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8957_RS11345 comGC 2364562..2364828 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  M8957_RS11350 comGD 2364818..2365255 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8957_RS11355 comGE 2365239..2365553 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8957_RS11360 comGF 2365462..2365962 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8957_RS11365 comGG 2365963..2366340 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8957_RS11370 - 2366397..2366576 (+) 180 WP_003153093.1 YqzE family protein -
  M8957_RS11375 - 2366616..2366945 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8957_RS11380 tapA 2367204..2367875 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8957_RS11385 - 2367847..2368431 (+) 585 WP_012117977.1 signal peptidase I -
  M8957_RS11390 - 2368496..2369281 (+) 786 WP_007408329.1 TasA family protein -
  M8957_RS11395 sinR 2369329..2369664 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8957_RS11400 sinI 2369698..2369871 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8957_RS11405 - 2370048..2370842 (-) 795 WP_012117976.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=690496 M8957_RS11365 WP_012117980.1 2365963..2366340(+) (comGG) [Bacillus velezensis strain UA0276]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=690496 M8957_RS11365 WP_012117980.1 2365963..2366340(+) (comGG) [Bacillus velezensis strain UA0276]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512