Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   M8249_RS06160 Genome accession   NZ_CP097574
Coordinates   1272998..1273525 (-) Length   175 a.a.
NCBI ID   WP_251940680.1    Uniprot ID   -
Organism   Weissella paramesenteroides strain JL-5     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1242575..1287640 1272998..1273525 within 0


Gene organization within MGE regions


Location: 1242575..1287640
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8249_RS05970 (M8249_05930) - 1242575..1243678 (-) 1104 WP_002828417.1 GH25 family lysozyme -
  M8249_RS05975 (M8249_05935) - 1243731..1243985 (-) 255 Protein_1125 phage holin -
  M8249_RS05980 (M8249_05940) - 1243978..1244259 (-) 282 WP_404974992.1 hypothetical protein -
  M8249_RS05985 (M8249_05945) - 1244306..1244584 (-) 279 WP_002828420.1 hypothetical protein -
  M8249_RS05990 (M8249_05950) - 1244587..1244982 (-) 396 WP_002828422.1 hypothetical protein -
  M8249_RS05995 (M8249_05955) - 1244992..1249842 (-) 4851 WP_002828424.1 phage tail spike protein -
  M8249_RS06000 (M8249_05960) - 1249839..1250645 (-) 807 WP_404974993.1 distal tail protein Dit -
  M8249_RS06005 (M8249_05965) - 1250664..1254161 (-) 3498 WP_404974994.1 phage tail tape measure protein -
  M8249_RS06010 (M8249_05970) - 1254162..1254476 (-) 315 WP_040760812.1 hypothetical protein -
  M8249_RS06015 (M8249_05975) - 1254587..1254925 (-) 339 WP_002828430.1 tail assembly chaperone -
  M8249_RS06020 (M8249_05980) - 1255049..1255612 (-) 564 WP_404974995.1 phage major tail protein, TP901-1 family -
  M8249_RS06025 (M8249_05985) - 1255628..1256023 (-) 396 WP_002828432.1 DUF3168 domain-containing protein -
  M8249_RS06030 (M8249_05990) - 1256020..1256394 (-) 375 WP_002828433.1 HK97-gp10 family putative phage morphogenesis protein -
  M8249_RS06035 (M8249_05995) - 1256384..1256698 (-) 315 WP_002828435.1 hypothetical protein -
  M8249_RS06040 (M8249_06000) - 1256708..1257052 (-) 345 WP_002828436.1 phage head-tail connector protein -
  M8249_RS06045 (M8249_06005) - 1257070..1257351 (-) 282 WP_002828437.1 hypothetical protein -
  M8249_RS06050 (M8249_06010) - 1257417..1258244 (-) 828 WP_002828438.1 N4-gp56 family major capsid protein -
  M8249_RS06055 (M8249_06015) - 1258248..1258844 (-) 597 WP_002828439.1 DUF4355 domain-containing protein -
  M8249_RS06060 (M8249_06020) - 1259012..1259977 (-) 966 WP_002828440.1 minor capsid protein -
  M8249_RS06065 (M8249_06025) - 1259967..1261460 (-) 1494 WP_002828441.1 phage portal protein -
  M8249_RS06070 (M8249_06030) - 1261471..1262760 (-) 1290 WP_002828443.1 PBSX family phage terminase large subunit -
  M8249_RS06075 (M8249_06035) - 1262753..1263259 (-) 507 WP_002828445.1 terminase small subunit -
  M8249_RS06080 (M8249_06040) - 1263438..1263647 (+) 210 WP_002828447.1 hypothetical protein -
  M8249_RS06085 (M8249_06045) - 1263847..1264419 (-) 573 WP_404974996.1 hypothetical protein -
  M8249_RS06090 (M8249_06050) - 1264996..1265202 (-) 207 WP_002828449.1 CsbD family protein -
  M8249_RS06095 (M8249_06055) - 1265301..1265546 (-) 246 WP_002828450.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  M8249_RS06105 (M8249_06065) - 1265875..1266336 (-) 462 WP_002828451.1 DUF722 domain-containing protein -
  M8249_RS06110 (M8249_06070) - 1266520..1268178 (+) 1659 WP_002828452.1 hypothetical protein -
  M8249_RS06115 (M8249_06075) - 1268338..1268793 (-) 456 WP_040760818.1 GAF domain-containing protein -
  M8249_RS06120 (M8249_06080) pnuC 1268861..1269556 (-) 696 WP_002828454.1 nicotinamide riboside transporter PnuC -
  M8249_RS06125 (M8249_06085) - 1269681..1269866 (-) 186 WP_002828455.1 hypothetical protein -
  M8249_RS06130 (M8249_06090) - 1269866..1270492 (-) 627 WP_131473418.1 hypothetical protein -
  M8249_RS06135 (M8249_06095) - 1270485..1270736 (-) 252 WP_259705395.1 hypothetical protein -
  M8249_RS06140 (M8249_06100) - 1270774..1271211 (-) 438 WP_277380235.1 dTDP-glucose pyrophosphorylase -
  M8249_RS06145 (M8249_06105) - 1271211..1271372 (-) 162 WP_330155772.1 hypothetical protein -
  M8249_RS06150 (M8249_06110) - 1271372..1272097 (-) 726 WP_404974997.1 ATP-binding protein -
  M8249_RS06155 (M8249_06115) - 1272084..1272989 (-) 906 WP_404974998.1 phage replisome organizer N-terminal domain-containing protein -
  M8249_RS06160 (M8249_06120) ssb 1272998..1273525 (-) 528 WP_251940680.1 single-stranded DNA-binding protein Machinery gene
  M8249_RS06165 (M8249_06125) - 1273488..1274198 (-) 711 WP_404974999.1 putative HNHc nuclease -
  M8249_RS06170 (M8249_06130) - 1274198..1274821 (-) 624 WP_251940684.1 ERF family protein -
  M8249_RS06175 (M8249_06135) - 1274832..1275257 (-) 426 WP_251940686.1 hypothetical protein -
  M8249_RS06180 (M8249_06140) - 1275261..1275398 (-) 138 WP_251940688.1 hypothetical protein -
  M8249_RS06185 (M8249_06145) - 1275447..1275671 (-) 225 WP_251940690.1 helix-turn-helix domain-containing protein -
  M8249_RS06190 (M8249_06150) - 1275646..1275858 (-) 213 WP_251940692.1 hypothetical protein -
  M8249_RS06195 (M8249_06155) - 1275938..1276237 (+) 300 WP_404975000.1 hypothetical protein -
  M8249_RS06200 (M8249_06160) - 1276243..1276521 (-) 279 WP_404975001.1 hypothetical protein -
  M8249_RS06205 (M8249_06165) - 1276559..1276768 (-) 210 WP_404975002.1 hypothetical protein -
  M8249_RS06210 (M8249_06170) - 1276770..1276964 (-) 195 WP_002828472.1 hypothetical protein -
  M8249_RS06215 (M8249_06175) - 1277082..1277294 (+) 213 WP_404975003.1 hypothetical protein -
  M8249_RS06220 (M8249_06180) - 1277700..1277942 (+) 243 WP_040760830.1 hypothetical protein -
  M8249_RS06225 (M8249_06185) - 1277992..1278717 (-) 726 WP_150222726.1 ORF6C domain-containing protein -
  M8249_RS06230 (M8249_06190) - 1278730..1278966 (-) 237 WP_115470253.1 hypothetical protein -
  M8249_RS06235 (M8249_06195) - 1279232..1279585 (+) 354 WP_131473405.1 helix-turn-helix domain-containing protein -
  M8249_RS06240 (M8249_06200) - 1279668..1280159 (+) 492 WP_259705196.1 hypothetical protein -
  M8249_RS06245 (M8249_06205) - 1280233..1280838 (+) 606 WP_259705192.1 DUF5067 domain-containing protein -
  M8249_RS06250 (M8249_06210) - 1281009..1282085 (+) 1077 WP_277362329.1 site-specific integrase -
  M8249_RS06260 (M8249_06220) - 1282380..1282886 (-) 507 WP_150177836.1 antibiotic biosynthesis monooxygenase -
  M8249_RS06265 (M8249_06225) - 1282980..1283708 (-) 729 WP_002828485.1 CPBP family intramembrane glutamic endopeptidase -
  M8249_RS06270 (M8249_06230) - 1283695..1283901 (-) 207 WP_040760843.1 hypothetical protein -
  M8249_RS06275 (M8249_06235) - 1283906..1284742 (-) 837 WP_002828487.1 Cof-type HAD-IIB family hydrolase -
  M8249_RS06280 (M8249_06240) mscL 1284922..1285314 (+) 393 WP_002828488.1 large conductance mechanosensitive channel protein MscL -
  M8249_RS06285 (M8249_06245) - 1285505..1286143 (+) 639 WP_002828489.1 deoxynucleoside kinase -
  M8249_RS06290 (M8249_06250) - 1286216..1287640 (-) 1425 WP_277362326.1 C40 family peptidase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19455.29 Da        Isoelectric Point: 8.4488

>NTDB_id=690247 M8249_RS06160 WP_251940680.1 1272998..1273525(-) (ssb) [Weissella paramesenteroides strain JL-5]
MINNVTLTGRLTKDMELKYTTSGTAVASATVAVERSFTDGNGERGSDFINFVIWRKAAENLAKMTAKGSLIGLEGRLQTR
SYDNQQGQKVFVTEVVVNNFSLLESKEVTDQRKQGGASQPQQNNFNQQPPQQNNFNQQQAPQGNFNQQRQQPQQNNFGGS
QGYGNGNNFEDQLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=690247 M8249_RS06160 WP_251940680.1 1272998..1273525(-) (ssb) [Weissella paramesenteroides strain JL-5]
ATGATAAACAACGTCACACTAACTGGCAGACTAACTAAAGATATGGAGTTGAAATATACCACGTCAGGTACAGCCGTAGC
CAGTGCAACAGTAGCAGTTGAACGCTCATTTACTGACGGTAATGGCGAACGAGGTAGTGACTTTATTAACTTTGTGATAT
GGCGTAAGGCGGCTGAAAATTTAGCTAAAATGACCGCTAAAGGTTCATTGATTGGACTGGAAGGACGTTTGCAAACACGT
AGCTATGATAACCAGCAAGGGCAAAAAGTATTTGTTACTGAAGTTGTCGTTAATAATTTTTCACTATTAGAAAGCAAGGA
AGTTACTGACCAGCGTAAGCAAGGTGGGGCTAGTCAACCACAACAAAATAACTTTAATCAACAGCCACCGCAACAAAACA
ATTTCAATCAACAGCAAGCACCACAAGGAAACTTCAATCAACAGCGCCAACAACCACAGCAAAATAATTTTGGTGGATCA
CAGGGGTATGGTAACGGCAATAACTTTGAAGACCAATTACCATTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

53.039

100

0.549
  ssbA Bacillus subtilis subsp. subtilis str. 168

60.377

60.571

0.366