Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | OTU45_RS03120 | Genome accession | NZ_CP113114 |
| Coordinates | 618988..619137 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain NP1 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 613988..624137
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OTU45_RS12025 | comA/nlmT | 613994..614581 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| OTU45_RS03075 (OTU45_03075) | blpI | 614895..615092 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| OTU45_RS03080 (OTU45_03080) | blpJ | 615559..615828 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| OTU45_RS03085 (OTU45_03085) | blpU | 615897..616127 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| OTU45_RS03090 (OTU45_03090) | - | 616130..616249 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| OTU45_RS03095 (OTU45_03095) | - | 616548..616712 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| OTU45_RS03100 (OTU45_03100) | - | 616709..617113 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| OTU45_RS03105 (OTU45_03105) | - | 617316..618121 (+) | 806 | Protein_609 | IS5 family transposase | - |
| OTU45_RS03110 (OTU45_03110) | blpM | 618271..618525 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| OTU45_RS03115 (OTU45_03115) | blpN | 618541..618744 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| OTU45_RS03120 (OTU45_03120) | cipB | 618988..619137 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| OTU45_RS03125 (OTU45_03125) | - | 619241..619360 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| OTU45_RS03130 (OTU45_03130) | - | 620146..620529 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| OTU45_RS03135 (OTU45_03135) | - | 620581..621270 (+) | 690 | WP_050233598.1 | CPBP family intramembrane glutamic endopeptidase | - |
| OTU45_RS03140 (OTU45_03140) | blpZ | 621312..621545 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| OTU45_RS03145 (OTU45_03145) | - | 621696..622307 (+) | 612 | WP_050202405.1 | CPBP family intramembrane glutamic endopeptidase | - |
| OTU45_RS03150 (OTU45_03150) | ccrZ | 622469..623263 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| OTU45_RS03155 (OTU45_03155) | trmB | 623260..623895 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=689654 OTU45_RS03120 WP_001818346.1 618988..619137(+) (cipB) [Streptococcus pneumoniae strain NP1]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=689654 OTU45_RS03120 WP_001818346.1 618988..619137(+) (cipB) [Streptococcus pneumoniae strain NP1]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |