Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M5E03_RS14795 Genome accession   NZ_CP097374
Coordinates   2846859..2846999 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain AHB11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2841859..2851999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5E03_RS14770 (M5E03_14770) - 2842124..2842513 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  M5E03_RS14775 (M5E03_14775) comA 2842537..2843178 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  M5E03_RS14780 (M5E03_14780) comP 2843259..2845571 (-) 2313 WP_041115820.1 ATP-binding protein Regulator
  M5E03_RS14785 (M5E03_14785) - 2845629..2845796 (-) 168 WP_080696376.1 competence pheromone ComX -
  M5E03_RS14790 (M5E03_14790) - 2845793..2846707 (-) 915 WP_041115818.1 polyprenyl synthetase family protein -
  M5E03_RS14795 (M5E03_14795) degQ 2846859..2846999 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  M5E03_RS14800 (M5E03_14800) - 2847505..2847861 (+) 357 WP_041115816.1 hypothetical protein -
  M5E03_RS14805 (M5E03_14805) - 2847897..2849123 (-) 1227 WP_024423326.1 EAL and HDOD domain-containing protein -
  M5E03_RS14810 (M5E03_14810) - 2849261..2850733 (-) 1473 WP_041115814.1 nicotinate phosphoribosyltransferase -
  M5E03_RS14815 (M5E03_14815) - 2850751..2851302 (-) 552 WP_087978057.1 cysteine hydrolase family protein -
  M5E03_RS14820 (M5E03_14820) - 2851363..2851770 (-) 408 WP_024423329.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=689279 M5E03_RS14795 WP_003213123.1 2846859..2846999(-) (degQ) [Bacillus safensis strain AHB11]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=689279 M5E03_RS14795 WP_003213123.1 2846859..2846999(-) (degQ) [Bacillus safensis strain AHB11]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696