Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   M5C55_RS09105 Genome accession   NZ_CP097359
Coordinates   1939462..1939899 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain H208     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1934462..1944899
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5C55_RS09055 (M5C55_09055) sinI 1934845..1935018 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  M5C55_RS09060 (M5C55_09060) sinR 1935052..1935387 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M5C55_RS09065 (M5C55_09065) - 1935435..1936220 (-) 786 WP_032874027.1 TasA family protein -
  M5C55_RS09070 (M5C55_09070) - 1936285..1936869 (-) 585 WP_032874025.1 signal peptidase I -
  M5C55_RS09075 (M5C55_09075) tapA 1936841..1937512 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M5C55_RS09080 (M5C55_09080) - 1937771..1938100 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M5C55_RS09085 (M5C55_09085) - 1938141..1938320 (-) 180 WP_022552966.1 YqzE family protein -
  M5C55_RS09090 (M5C55_09090) comGG 1938377..1938754 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M5C55_RS09095 (M5C55_09095) comGF 1938755..1939219 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  M5C55_RS09100 (M5C55_09100) comGE 1939164..1939478 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M5C55_RS09105 (M5C55_09105) comGD 1939462..1939899 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  M5C55_RS09110 (M5C55_09110) comGC 1939889..1940197 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M5C55_RS09115 (M5C55_09115) comGB 1940202..1941239 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  M5C55_RS09120 (M5C55_09120) comGA 1941226..1942296 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M5C55_RS09125 (M5C55_09125) - 1942493..1943443 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  M5C55_RS09130 (M5C55_09130) - 1943589..1944890 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=689036 M5C55_RS09105 WP_007612572.1 1939462..1939899(-) (comGD) [Bacillus velezensis strain H208]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=689036 M5C55_RS09105 WP_007612572.1 1939462..1939899(-) (comGD) [Bacillus velezensis strain H208]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559