Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M5J22_RS15005 Genome accession   NZ_CP097326
Coordinates   3071718..3071858 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GUCC45     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3066718..3076858
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5J22_RS14980 (M5J22_14980) - 3067046..3067429 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  M5J22_RS14985 (M5J22_14985) comA 3067451..3068095 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  M5J22_RS14990 (M5J22_14990) - 3068176..3070481 (-) 2306 Protein_2896 sensor histidine kinase -
  M5J22_RS14995 (M5J22_14995) comX 3070500..3070676 (-) 177 WP_044052947.1 competence pheromone ComX -
  M5J22_RS15000 (M5J22_15000) - 3070691..3071587 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  M5J22_RS15005 (M5J22_15005) degQ 3071718..3071858 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  M5J22_RS15010 (M5J22_15010) - 3072324..3072665 (+) 342 WP_003152040.1 hypothetical protein -
  M5J22_RS15015 (M5J22_15015) - 3072672..3073892 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  M5J22_RS15020 (M5J22_15020) - 3074022..3075488 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  M5J22_RS15025 (M5J22_15025) - 3075506..3076057 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  M5J22_RS15030 (M5J22_15030) - 3076154..3076552 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=688490 M5J22_RS15005 WP_003152043.1 3071718..3071858(-) (degQ) [Bacillus velezensis strain GUCC45]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=688490 M5J22_RS15005 WP_003152043.1 3071718..3071858(-) (degQ) [Bacillus velezensis strain GUCC45]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891