Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M5J22_RS12025 Genome accession   NZ_CP097326
Coordinates   2507615..2507788 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain GUCC45     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2502615..2512788
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5J22_RS12010 (M5J22_12010) gcvT 2503433..2504533 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  M5J22_RS12015 (M5J22_12015) - 2504956..2506626 (+) 1671 WP_003153107.1 SNF2-related protein -
  M5J22_RS12020 (M5J22_12020) - 2506644..2507438 (+) 795 WP_201489007.1 YqhG family protein -
  M5J22_RS12025 (M5J22_12025) sinI 2507615..2507788 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  M5J22_RS12030 (M5J22_12030) sinR 2507822..2508157 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M5J22_RS12035 (M5J22_12035) - 2508205..2508990 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  M5J22_RS12040 (M5J22_12040) - 2509054..2509638 (-) 585 WP_012117977.1 signal peptidase I SipW -
  M5J22_RS12045 (M5J22_12045) tapA 2509610..2510281 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  M5J22_RS12050 (M5J22_12050) - 2510540..2510869 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  M5J22_RS12055 (M5J22_12055) - 2510909..2511088 (-) 180 WP_003153093.1 YqzE family protein -
  M5J22_RS12060 (M5J22_12060) comGG 2511145..2511522 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  M5J22_RS12065 (M5J22_12065) comGF 2511523..2511918 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  M5J22_RS12070 (M5J22_12070) comGE 2511932..2512246 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  M5J22_RS12075 (M5J22_12075) comGD 2512230..2512667 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=688469 M5J22_RS12025 WP_003153105.1 2507615..2507788(+) (sinI) [Bacillus velezensis strain GUCC45]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=688469 M5J22_RS12025 WP_003153105.1 2507615..2507788(+) (sinI) [Bacillus velezensis strain GUCC45]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702