Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   M5J22_RS12070 Genome accession   NZ_CP097326
Coordinates   2511932..2512246 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain GUCC45     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2506932..2517246
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5J22_RS12025 (M5J22_12025) sinI 2507615..2507788 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  M5J22_RS12030 (M5J22_12030) sinR 2507822..2508157 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M5J22_RS12035 (M5J22_12035) - 2508205..2508990 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  M5J22_RS12040 (M5J22_12040) - 2509054..2509638 (-) 585 WP_012117977.1 signal peptidase I SipW -
  M5J22_RS12045 (M5J22_12045) tapA 2509610..2510281 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  M5J22_RS12050 (M5J22_12050) - 2510540..2510869 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  M5J22_RS12055 (M5J22_12055) - 2510909..2511088 (-) 180 WP_003153093.1 YqzE family protein -
  M5J22_RS12060 (M5J22_12060) comGG 2511145..2511522 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  M5J22_RS12065 (M5J22_12065) comGF 2511523..2511918 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  M5J22_RS12070 (M5J22_12070) comGE 2511932..2512246 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  M5J22_RS12075 (M5J22_12075) comGD 2512230..2512667 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  M5J22_RS12080 (M5J22_12080) comGC 2512657..2512965 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M5J22_RS12085 (M5J22_12085) comGB 2512970..2514007 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  M5J22_RS12090 (M5J22_12090) comGA 2513994..2515064 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M5J22_RS12095 (M5J22_12095) - 2515256..2516206 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=688472 M5J22_RS12070 WP_015388003.1 2511932..2512246(-) (comGE) [Bacillus velezensis strain GUCC45]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=688472 M5J22_RS12070 WP_015388003.1 2511932..2512246(-) (comGE) [Bacillus velezensis strain GUCC45]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTTAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481