Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M2893_RS16280 Genome accession   NZ_CP097208
Coordinates   3256242..3256382 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain N3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251242..3261382
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2893_RS16255 (M2893_16255) - 3251569..3251952 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  M2893_RS16260 (M2893_16260) comA 3251974..3252618 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  M2893_RS16265 (M2893_16265) comP 3252699..3255005 (-) 2307 WP_249485065.1 sensor histidine kinase Regulator
  M2893_RS16270 (M2893_16270) comX 3255024..3255200 (-) 177 WP_044052947.1 competence pheromone ComX -
  M2893_RS16275 (M2893_16275) - 3255215..3256111 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  M2893_RS16280 (M2893_16280) degQ 3256242..3256382 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  M2893_RS16285 (M2893_16285) - 3256848..3257189 (+) 342 WP_014305721.1 hypothetical protein -
  M2893_RS16290 (M2893_16290) - 3257196..3258416 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  M2893_RS16295 (M2893_16295) - 3258546..3260012 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  M2893_RS16300 (M2893_16300) - 3260030..3260581 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  M2893_RS16305 (M2893_16305) - 3260678..3261076 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=687801 M2893_RS16280 WP_003152043.1 3256242..3256382(-) (degQ) [Bacillus velezensis strain N3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=687801 M2893_RS16280 WP_003152043.1 3256242..3256382(-) (degQ) [Bacillus velezensis strain N3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891