Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   M2893_RS13030 Genome accession   NZ_CP097208
Coordinates   2662419..2662856 (-) Length   145 a.a.
NCBI ID   WP_003153088.1    Uniprot ID   -
Organism   Bacillus velezensis strain N3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2657419..2667856
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2893_RS12980 (M2893_12980) sinI 2657804..2657977 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M2893_RS12985 (M2893_12985) sinR 2658011..2658346 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M2893_RS12990 (M2893_12990) - 2658394..2659179 (-) 786 WP_003153102.1 TasA family protein -
  M2893_RS12995 (M2893_12995) - 2659243..2659827 (-) 585 WP_003153100.1 signal peptidase I -
  M2893_RS13000 (M2893_13000) tapA 2659799..2660470 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  M2893_RS13005 (M2893_13005) - 2660729..2661058 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  M2893_RS13010 (M2893_13010) - 2661098..2661277 (-) 180 WP_003153093.1 YqzE family protein -
  M2893_RS13015 (M2893_13015) comGG 2661334..2661711 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  M2893_RS13020 (M2893_13020) comGF 2661712..2662212 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  M2893_RS13025 (M2893_13025) comGE 2662121..2662435 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  M2893_RS13030 (M2893_13030) comGD 2662419..2662856 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  M2893_RS13035 (M2893_13035) comGC 2662846..2663154 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M2893_RS13040 (M2893_13040) comGB 2663159..2664196 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  M2893_RS13045 (M2893_13045) comGA 2664183..2665253 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M2893_RS13050 (M2893_13050) - 2665445..2666395 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  M2893_RS13055 (M2893_13055) - 2666541..2667842 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16324.85 Da        Isoelectric Point: 10.3725

>NTDB_id=687783 M2893_RS13030 WP_003153088.1 2662419..2662856(-) (comGD) [Bacillus velezensis strain N3]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPREHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=687783 M2893_RS13030 WP_003153088.1 2662419..2662856(-) (comGD) [Bacillus velezensis strain N3]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAGAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552