Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M2893_RS12980 Genome accession   NZ_CP097208
Coordinates   2657804..2657977 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain N3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2652804..2662977
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2893_RS12965 (M2893_12965) gcvT 2653622..2654722 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  M2893_RS12970 (M2893_12970) - 2655145..2656815 (+) 1671 WP_003153107.1 SNF2-related protein -
  M2893_RS12975 (M2893_12975) - 2656833..2657627 (+) 795 WP_014305407.1 YqhG family protein -
  M2893_RS12980 (M2893_12980) sinI 2657804..2657977 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M2893_RS12985 (M2893_12985) sinR 2658011..2658346 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M2893_RS12990 (M2893_12990) - 2658394..2659179 (-) 786 WP_003153102.1 TasA family protein -
  M2893_RS12995 (M2893_12995) - 2659243..2659827 (-) 585 WP_003153100.1 signal peptidase I -
  M2893_RS13000 (M2893_13000) tapA 2659799..2660470 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  M2893_RS13005 (M2893_13005) - 2660729..2661058 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  M2893_RS13010 (M2893_13010) - 2661098..2661277 (-) 180 WP_003153093.1 YqzE family protein -
  M2893_RS13015 (M2893_13015) comGG 2661334..2661711 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  M2893_RS13020 (M2893_13020) comGF 2661712..2662212 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  M2893_RS13025 (M2893_13025) comGE 2662121..2662435 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  M2893_RS13030 (M2893_13030) comGD 2662419..2662856 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=687780 M2893_RS12980 WP_003153105.1 2657804..2657977(+) (sinI) [Bacillus velezensis strain N3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=687780 M2893_RS12980 WP_003153105.1 2657804..2657977(+) (sinI) [Bacillus velezensis strain N3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702