Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M2M89_RS15920 Genome accession   NZ_CP097130
Coordinates   3085989..3086129 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain S16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3080989..3091129
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2M89_RS15895 yuxO 3081266..3081646 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  M2M89_RS15900 comA 3081665..3082309 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  M2M89_RS15905 - 3082390..3084702 (-) 2313 Protein_3077 histidine kinase -
  M2M89_RS15910 comX 3084718..3084939 (-) 222 WP_014480704.1 competence pheromone ComX -
  M2M89_RS15915 - 3084941..3085804 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  M2M89_RS15920 degQ 3085989..3086129 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  M2M89_RS15925 - 3086351..3086413 (+) 63 Protein_3081 hypothetical protein -
  M2M89_RS15930 - 3086592..3086960 (+) 369 WP_041850584.1 hypothetical protein -
  M2M89_RS15935 pdeH 3086936..3088165 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  M2M89_RS15940 pncB 3088302..3089774 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  M2M89_RS15945 pncA 3089790..3090341 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  M2M89_RS15950 yueI 3090438..3090836 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=687455 M2M89_RS15920 WP_003220708.1 3085989..3086129(-) (degQ) [Bacillus subtilis strain S16]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=687455 M2M89_RS15920 WP_003220708.1 3085989..3086129(-) (degQ) [Bacillus subtilis strain S16]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1