Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   M2906_RS10245 Genome accession   NZ_CP097048
Coordinates   2129528..2130055 (-) Length   175 a.a.
NCBI ID   WP_010784196.1    Uniprot ID   -
Organism   Enterococcus faecalis strain AT22     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2088392..2145190 2129528..2130055 within 0


Gene organization within MGE regions


Location: 2088392..2145190
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2906_RS09995 (M2906_09950) - 2088392..2088751 (-) 360 WP_002359675.1 arsenate reductase family protein -
  M2906_RS10000 (M2906_09955) - 2088776..2089963 (-) 1188 WP_002356636.1 FtsW/RodA/SpoVE family cell cycle protein -
  M2906_RS10005 (M2906_09960) - 2090207..2091643 (-) 1437 WP_002380625.1 helix-turn-helix domain-containing protein -
  M2906_RS10010 (M2906_09965) - 2091644..2092345 (-) 702 WP_002356634.1 bacterial Ig-like domain-containing protein -
  M2906_RS10015 (M2906_09970) - 2092544..2097286 (-) 4743 WP_010710632.1 bacterial Ig-like domain-containing protein -
  M2906_RS10020 (M2906_09975) - 2097461..2098792 (-) 1332 WP_002391305.1 hypothetical protein -
  M2906_RS10025 (M2906_09980) - 2098905..2099456 (-) 552 WP_002362234.1 XRE family transcriptional regulator -
  M2906_RS10030 (M2906_09985) - 2099670..2100377 (+) 708 WP_002356628.1 AzlC family ABC transporter permease -
  M2906_RS10035 (M2906_09990) - 2100364..2100690 (+) 327 WP_010710633.1 AzlD domain-containing protein -
  M2906_RS10040 (M2906_09995) - 2100942..2101427 (-) 486 WP_248868722.1 hypothetical protein -
  M2906_RS10050 (M2906_10005) - 2101753..2102280 (-) 528 WP_002404951.1 type II toxin-antitoxin system PemK/MazF family toxin -
  M2906_RS10055 (M2906_10010) - 2103180..2103593 (+) 414 WP_002404950.1 hypothetical protein -
  M2906_RS10060 (M2906_10015) - 2103658..2104761 (-) 1104 WP_002404949.1 SH3 domain-containing protein -
  M2906_RS10065 (M2906_10020) - 2104803..2105009 (-) 207 WP_002395769.1 BhlA/UviB family holin-like peptide -
  M2906_RS10070 (M2906_10025) - 2105035..2106252 (-) 1218 WP_002398465.1 glycerophosphodiester phosphodiesterase -
  M2906_RS10075 (M2906_10030) - 2106252..2106569 (-) 318 WP_002372011.1 hypothetical protein -
  M2906_RS10080 (M2906_10035) - 2106569..2106877 (-) 309 WP_002404948.1 hypothetical protein -
  M2906_RS10085 (M2906_10040) - 2106877..2107779 (-) 903 WP_248868724.1 phage baseplate upper protein -
  M2906_RS10090 (M2906_10045) - 2107798..2110605 (-) 2808 WP_248868726.1 phage tail spike protein -
  M2906_RS10095 (M2906_10050) - 2110587..2111321 (-) 735 WP_002402410.1 tail protein -
  M2906_RS10100 (M2906_10055) - 2111311..2114208 (-) 2898 WP_248868811.1 tape measure protein -
  M2906_RS10105 (M2906_10060) - 2114457..2114810 (-) 354 WP_002364485.1 hypothetical protein -
  M2906_RS10110 (M2906_10065) - 2114863..2115705 (-) 843 WP_113847605.1 major tail protein -
  M2906_RS10115 (M2906_10070) - 2115706..2116080 (-) 375 WP_002402414.1 DUF6838 family protein -
  M2906_RS10120 (M2906_10075) - 2116084..2116482 (-) 399 WP_002402415.1 HK97 gp10 family phage protein -
  M2906_RS10125 (M2906_10080) - 2116475..2116852 (-) 378 WP_002402416.1 hypothetical protein -
  M2906_RS10130 (M2906_10085) - 2116849..2117193 (-) 345 WP_002402417.1 hypothetical protein -
  M2906_RS10135 (M2906_10090) - 2117202..2117438 (-) 237 WP_002402418.1 hypothetical protein -
  M2906_RS10140 (M2906_10095) - 2117462..2118364 (-) 903 WP_016634610.1 DUF5309 family protein -
  M2906_RS10145 (M2906_10100) - 2118378..2119004 (-) 627 WP_085443280.1 DUF4355 domain-containing protein -
  M2906_RS10150 (M2906_10105) - 2119145..2119408 (-) 264 WP_025189865.1 DUF6275 family protein -
  M2906_RS10155 (M2906_10110) - 2119476..2119796 (-) 321 WP_104681295.1 hypothetical protein -
  M2906_RS10160 (M2906_10115) - 2119799..2120845 (-) 1047 WP_113848047.1 phage head morphogenesis protein -
  M2906_RS10165 (M2906_10120) - 2120820..2122295 (-) 1476 WP_248868728.1 phage portal protein -
  M2906_RS10170 (M2906_10125) terL 2122308..2123696 (-) 1389 WP_095715043.1 phage terminase large subunit -
  M2906_RS10175 (M2906_10130) - 2123689..2124150 (-) 462 WP_010828975.1 helix-turn-helix domain-containing protein -
  M2906_RS10180 (M2906_10135) - 2124217..2125011 (-) 795 WP_248868730.1 hypothetical protein -
  M2906_RS10185 (M2906_10140) - 2125259..2125678 (-) 420 WP_113847235.1 transcriptional regulator -
  M2906_RS10190 (M2906_10145) - 2125679..2125891 (-) 213 WP_174098294.1 hypothetical protein -
  M2906_RS10195 (M2906_10150) - 2125885..2126202 (-) 318 WP_248868732.1 replicase -
  M2906_RS10200 (M2906_10155) - 2126216..2126647 (-) 432 WP_248868734.1 ASCH/PUA domain-containing protein -
  M2906_RS10205 (M2906_10160) - 2126651..2127157 (-) 507 WP_248868736.1 DUF1642 domain-containing protein -
  M2906_RS10210 (M2906_10165) - 2127366..2127533 (-) 168 WP_202228917.1 hypothetical protein -
  M2906_RS10215 (M2906_10170) - 2127530..2127772 (-) 243 WP_248868739.1 hypothetical protein -
  M2906_RS10220 (M2906_10175) - 2127772..2128131 (-) 360 WP_248868741.1 hypothetical protein -
  M2906_RS10225 (M2906_10180) - 2128128..2128505 (-) 378 WP_248868813.1 YopX family protein -
  M2906_RS10230 (M2906_10185) - 2128679..2128903 (+) 225 WP_248868743.1 hypothetical protein -
  M2906_RS10235 (M2906_10190) - 2128961..2129167 (-) 207 WP_248868745.1 hypothetical protein -
  M2906_RS10240 (M2906_10195) - 2129187..2129516 (-) 330 WP_033600926.1 hypothetical protein -
  M2906_RS10245 (M2906_10200) ssb 2129528..2130055 (-) 528 WP_010784196.1 single-stranded DNA-binding protein Machinery gene
  M2906_RS10250 (M2906_10205) - 2130045..2130353 (-) 309 WP_172760873.1 MazG-like family protein -
  M2906_RS10255 (M2906_10210) - 2130353..2131204 (-) 852 WP_142430271.1 DNA replication protein -
  M2906_RS10260 (M2906_10215) - 2131224..2131865 (-) 642 WP_172760874.1 putative HNHc nuclease -
  M2906_RS10265 (M2906_10220) - 2131870..2132886 (-) 1017 WP_105194729.1 AAA family ATPase -
  M2906_RS10270 (M2906_10225) - 2132898..2133377 (-) 480 WP_002381628.1 siphovirus Gp157 family protein -
  M2906_RS14440 - 2133361..2133483 (-) 123 WP_002364322.1 hypothetical protein -
  M2906_RS10275 (M2906_10230) - 2133568..2133870 (-) 303 WP_010828389.1 hypothetical protein -
  M2906_RS10280 (M2906_10235) - 2133978..2134151 (-) 174 WP_002364664.1 hypothetical protein -
  M2906_RS10285 (M2906_10240) - 2134163..2134348 (-) 186 WP_002364665.1 hypothetical protein -
  M2906_RS10290 (M2906_10245) - 2134359..2135066 (-) 708 Protein_2015 Rha family transcriptional regulator -
  M2906_RS10295 (M2906_10250) - 2135020..2135301 (-) 282 WP_002365010.1 hypothetical protein -
  M2906_RS10300 (M2906_10255) - 2135313..2135495 (-) 183 WP_002358110.1 hypothetical protein -
  M2906_RS10305 (M2906_10260) - 2135787..2136110 (+) 324 WP_002365011.1 helix-turn-helix transcriptional regulator -
  M2906_RS10310 (M2906_10265) - 2136127..2136549 (+) 423 WP_002365012.1 ImmA/IrrE family metallo-endopeptidase -
  M2906_RS10315 (M2906_10270) - 2136631..2137215 (+) 585 WP_002365014.1 DUF4352 domain-containing protein -
  M2906_RS10320 (M2906_10275) - 2137341..2138510 (+) 1170 WP_105194730.1 tyrosine-type recombinase/integrase -
  M2906_RS10330 (M2906_10285) - 2138866..2139102 (+) 237 WP_002381528.1 hypothetical protein -
  M2906_RS10335 (M2906_10290) - 2139176..2139448 (-) 273 WP_002362236.1 membrane protein -
  M2906_RS10340 (M2906_10295) upp 2139554..2140183 (-) 630 WP_002356624.1 uracil phosphoribosyltransferase -
  M2906_RS10345 (M2906_10300) glyA 2140315..2141553 (-) 1239 WP_002356623.1 serine hydroxymethyltransferase -
  M2906_RS10350 (M2906_10305) - 2141629..2142651 (-) 1023 WP_010710634.1 L-threonylcarbamoyladenylate synthase -
  M2906_RS10355 (M2906_10310) prmC 2142695..2143528 (-) 834 WP_002370481.1 peptide chain release factor N(5)-glutamine methyltransferase -
  M2906_RS10360 (M2906_10315) prfA 2143521..2144594 (-) 1074 WP_002356619.1 peptide chain release factor 1 -
  M2906_RS10365 (M2906_10320) - 2144606..2145190 (-) 585 WP_002356618.1 thymidine kinase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19331.17 Da        Isoelectric Point: 4.7078

>NTDB_id=686660 M2906_RS10245 WP_010784196.1 2129528..2130055(-) (ssb) [Enterococcus faecalis strain AT22]
MINNVVLVGRLTKDLDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=686660 M2906_RS10245 WP_010784196.1 2129528..2130055(-) (ssb) [Enterococcus faecalis strain AT22]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCTTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGTCAAAAAG
CACCAATGAGAATAGAAATAGCGTTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCATTCGCA
GGTGCAGGTAATTCAATCGACATTAGTGATGATGATCTGCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

60.112

100

0.611
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.427

100

0.594