Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   OOZ27_RS13795 Genome accession   NZ_CP110634
Coordinates   2592572..2592745 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain MG-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2587572..2597745
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OOZ27_RS13780 (OOZ27_13780) gcvT 2588371..2589459 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  OOZ27_RS13785 (OOZ27_13785) hepAA 2589901..2591574 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  OOZ27_RS13790 (OOZ27_13790) yqhG 2591595..2592389 (+) 795 WP_015714249.1 YqhG family protein -
  OOZ27_RS13795 (OOZ27_13795) sinI 2592572..2592745 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OOZ27_RS13800 (OOZ27_13800) sinR 2592779..2593114 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OOZ27_RS13805 (OOZ27_13805) tasA 2593207..2593992 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  OOZ27_RS13810 (OOZ27_13810) sipW 2594056..2594628 (-) 573 WP_003230181.1 signal peptidase I SipW -
  OOZ27_RS13815 (OOZ27_13815) tapA 2594612..2595373 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  OOZ27_RS13820 (OOZ27_13820) yqzG 2595645..2595971 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OOZ27_RS13825 (OOZ27_13825) spoIITA 2596013..2596192 (-) 180 WP_014480252.1 YqzE family protein -
  OOZ27_RS13830 (OOZ27_13830) comGG 2596263..2596637 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  OOZ27_RS13835 (OOZ27_13835) comGF 2596638..2597021 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  OOZ27_RS13840 (OOZ27_13840) comGE 2597047..2597394 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=685134 OOZ27_RS13795 WP_003230187.1 2592572..2592745(+) (sinI) [Bacillus subtilis strain MG-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=685134 OOZ27_RS13795 WP_003230187.1 2592572..2592745(+) (sinI) [Bacillus subtilis strain MG-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1