Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   OOZ27_RS13835 Genome accession   NZ_CP110634
Coordinates   2596638..2597021 (-) Length   127 a.a.
NCBI ID   WP_038429292.1    Uniprot ID   -
Organism   Bacillus subtilis strain MG-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2591638..2602021
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OOZ27_RS13795 (OOZ27_13795) sinI 2592572..2592745 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OOZ27_RS13800 (OOZ27_13800) sinR 2592779..2593114 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OOZ27_RS13805 (OOZ27_13805) tasA 2593207..2593992 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  OOZ27_RS13810 (OOZ27_13810) sipW 2594056..2594628 (-) 573 WP_003230181.1 signal peptidase I SipW -
  OOZ27_RS13815 (OOZ27_13815) tapA 2594612..2595373 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  OOZ27_RS13820 (OOZ27_13820) yqzG 2595645..2595971 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OOZ27_RS13825 (OOZ27_13825) spoIITA 2596013..2596192 (-) 180 WP_014480252.1 YqzE family protein -
  OOZ27_RS13830 (OOZ27_13830) comGG 2596263..2596637 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  OOZ27_RS13835 (OOZ27_13835) comGF 2596638..2597021 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  OOZ27_RS13840 (OOZ27_13840) comGE 2597047..2597394 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  OOZ27_RS13845 (OOZ27_13845) comGD 2597378..2597809 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  OOZ27_RS13850 (OOZ27_13850) comGC 2597799..2598095 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  OOZ27_RS13855 (OOZ27_13855) comGB 2598109..2599146 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  OOZ27_RS13860 (OOZ27_13860) comGA 2599133..2600203 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  OOZ27_RS13865 (OOZ27_13865) - 2600415..2600612 (-) 198 WP_014480259.1 CBS domain-containing protein -
  OOZ27_RS13870 (OOZ27_13870) corA 2600614..2601567 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14547.68 Da        Isoelectric Point: 6.4849

>NTDB_id=685137 OOZ27_RS13835 WP_038429292.1 2596638..2597021(-) (comGF) [Bacillus subtilis strain MG-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=685137 OOZ27_RS13835 WP_038429292.1 2596638..2597021(-) (comGF) [Bacillus subtilis strain MG-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.619

99.213

0.969