Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EFK13_RS16270 Genome accession   NZ_CP096889
Coordinates   3169072..3169212 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus cabrialesii strain TE3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3164072..3174212
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EFK13_RS16245 (EFK13_16245) - 3164420..3164800 (-) 381 WP_064816560.1 hotdog fold thioesterase -
  EFK13_RS16250 (EFK13_16250) comA 3164821..3165465 (-) 645 WP_064816492.1 two-component system response regulator ComA Regulator
  EFK13_RS16255 (EFK13_16255) comP 3165546..3167843 (-) 2298 WP_129507720.1 histidine kinase Regulator
  EFK13_RS16260 (EFK13_16260) comX 3167851..3168012 (-) 162 WP_105955475.1 competence pheromone ComX -
  EFK13_RS16265 (EFK13_16265) - 3168027..3168887 (-) 861 WP_129507719.1 polyprenyl synthetase family protein -
  EFK13_RS16270 (EFK13_16270) degQ 3169072..3169212 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EFK13_RS16275 (EFK13_16275) - 3169437..3169514 (+) 78 Protein_3146 hypothetical protein -
  EFK13_RS16280 (EFK13_16280) - 3169673..3170041 (+) 369 WP_129507718.1 hypothetical protein -
  EFK13_RS16285 (EFK13_16285) pdeH 3170017..3171246 (-) 1230 WP_129507717.1 cyclic di-GMP phosphodiesterase -
  EFK13_RS16290 (EFK13_16290) - 3171383..3172855 (-) 1473 WP_129507716.1 nicotinate phosphoribosyltransferase -
  EFK13_RS16295 (EFK13_16295) - 3172871..3173422 (-) 552 WP_129507715.1 isochorismatase family cysteine hydrolase -
  EFK13_RS16300 (EFK13_16300) - 3173519..3173917 (-) 399 WP_129507714.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=684901 EFK13_RS16270 WP_003220708.1 3169072..3169212(-) (degQ) [Bacillus cabrialesii strain TE3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=684901 EFK13_RS16270 WP_003220708.1 3169072..3169212(-) (degQ) [Bacillus cabrialesii strain TE3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1