Detailed information
Overview
| Name | xcpV | Type | Machinery gene |
| Locus tag | M1S25_RS10700 | Genome accession | NZ_CP096722 |
| Coordinates | 2215945..2216325 (-) | Length | 126 a.a. |
| NCBI ID | WP_000836911.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain 5736 | ||
| Function | pseudopilus assembly (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2166954..2225964 | 2215945..2216325 | within | 0 |
Gene organization within MGE regions
Location: 2166954..2225964
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1S25_RS10360 (M1S25_10360) | - | 2166954..2167463 (-) | 510 | WP_000095892.1 | lysozyme | - |
| M1S25_RS10365 (M1S25_10365) | - | 2167447..2167713 (-) | 267 | WP_000774828.1 | holin | - |
| M1S25_RS10370 (M1S25_10370) | - | 2167788..2168012 (-) | 225 | WP_001104854.1 | hypothetical protein | - |
| M1S25_RS10375 (M1S25_10375) | - | 2168014..2170050 (-) | 2037 | WP_002018761.1 | hypothetical protein | - |
| M1S25_RS10380 (M1S25_10380) | - | 2170104..2172939 (-) | 2836 | Protein_2019 | host specificity factor TipJ family phage tail protein | - |
| M1S25_RS10385 (M1S25_10385) | - | 2172890..2173285 (-) | 396 | WP_236753102.1 | hypothetical protein | - |
| M1S25_RS10390 (M1S25_10390) | - | 2173282..2173791 (-) | 510 | WP_000587324.1 | DUF1833 family protein | - |
| M1S25_RS10395 (M1S25_10395) | - | 2173794..2174255 (-) | 462 | WP_000882463.1 | hypothetical protein | - |
| M1S25_RS10400 (M1S25_10400) | - | 2174271..2177867 (-) | 3597 | WP_047938240.1 | transglycosylase SLT domain-containing protein | - |
| M1S25_RS10405 (M1S25_10405) | - | 2177973..2178206 (-) | 234 | WP_249370374.1 | hypothetical protein | - |
| M1S25_RS10410 (M1S25_10410) | - | 2178350..2178565 (-) | 216 | WP_031978725.1 | hypothetical protein | - |
| M1S25_RS10415 (M1S25_10415) | - | 2178601..2179116 (-) | 516 | WP_236753104.1 | phage tail assembly chaperone family protein, TAC | - |
| M1S25_RS10420 (M1S25_10420) | - | 2179118..2179594 (-) | 477 | WP_001062223.1 | phage tail tube protein | - |
| M1S25_RS10425 (M1S25_10425) | - | 2179666..2180040 (-) | 375 | WP_000598741.1 | DUF3168 domain-containing protein | - |
| M1S25_RS10430 (M1S25_10430) | - | 2180040..2180525 (-) | 486 | WP_000235306.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M1S25_RS10435 (M1S25_10435) | - | 2180529..2180885 (-) | 357 | WP_001139340.1 | phage head closure protein | - |
| M1S25_RS10440 (M1S25_10440) | - | 2180887..2181174 (-) | 288 | WP_000631202.1 | head-tail connector protein | - |
| M1S25_RS10445 (M1S25_10445) | - | 2181171..2181347 (-) | 177 | WP_000666093.1 | hypothetical protein | - |
| M1S25_RS10450 (M1S25_10450) | - | 2181395..2182567 (-) | 1173 | WP_000137059.1 | phage major capsid protein | - |
| M1S25_RS10455 (M1S25_10455) | - | 2182560..2183222 (-) | 663 | WP_000375469.1 | HK97 family phage prohead protease | - |
| M1S25_RS10460 (M1S25_10460) | - | 2183215..2184441 (-) | 1227 | WP_000108390.1 | phage portal protein | - |
| M1S25_RS10465 (M1S25_10465) | - | 2184438..2186132 (-) | 1695 | WP_000125540.1 | terminase large subunit | - |
| M1S25_RS10470 (M1S25_10470) | - | 2186304..2186495 (-) | 192 | WP_001191044.1 | hypothetical protein | - |
| M1S25_RS10475 (M1S25_10475) | - | 2186515..2186997 (-) | 483 | WP_001219090.1 | terminase small subunit | - |
| M1S25_RS10480 (M1S25_10480) | - | 2186988..2187146 (-) | 159 | WP_166739911.1 | hypothetical protein | - |
| M1S25_RS10485 (M1S25_10485) | - | 2187158..2187370 (-) | 213 | WP_038338979.1 | hypothetical protein | - |
| M1S25_RS10490 (M1S25_10490) | - | 2187367..2187666 (-) | 300 | WP_000776297.1 | HNH endonuclease | - |
| M1S25_RS10495 (M1S25_10495) | - | 2187596..2187886 (-) | 291 | WP_017724759.1 | hypothetical protein | - |
| M1S25_RS10500 (M1S25_10500) | - | 2187864..2188421 (-) | 558 | WP_017724760.1 | hypothetical protein | - |
| M1S25_RS10505 (M1S25_10505) | - | 2188530..2188763 (-) | 234 | WP_249370375.1 | hypothetical protein | - |
| M1S25_RS10510 (M1S25_10510) | - | 2188768..2188992 (-) | 225 | WP_134232931.1 | hypothetical protein | - |
| M1S25_RS10515 (M1S25_10515) | - | 2188982..2189512 (-) | 531 | WP_134232932.1 | hypothetical protein | - |
| M1S25_RS10520 (M1S25_10520) | - | 2189528..2189926 (-) | 399 | WP_134232933.1 | hypothetical protein | - |
| M1S25_RS10525 (M1S25_10525) | - | 2190002..2190220 (-) | 219 | WP_000238616.1 | hypothetical protein | - |
| M1S25_RS20450 | - | 2190415..2190549 (+) | 135 | WP_017724763.1 | hypothetical protein | - |
| M1S25_RS10535 (M1S25_10535) | - | 2190677..2190907 (-) | 231 | WP_017724764.1 | hypothetical protein | - |
| M1S25_RS10540 (M1S25_10540) | - | 2191198..2192094 (-) | 897 | WP_134232934.1 | hypothetical protein | - |
| M1S25_RS10545 (M1S25_10545) | - | 2192160..2192633 (-) | 474 | WP_002000320.1 | hypothetical protein | - |
| M1S25_RS10550 (M1S25_10550) | - | 2192660..2192938 (-) | 279 | WP_000847048.1 | hypothetical protein | - |
| M1S25_RS20400 | - | 2192935..2193456 (-) | 522 | WP_346731800.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M1S25_RS20405 | - | 2193554..2194345 (-) | 792 | WP_283253749.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M1S25_RS10560 (M1S25_10560) | - | 2194342..2195313 (-) | 972 | WP_249370376.1 | YdaU family protein | - |
| M1S25_RS10565 (M1S25_10565) | - | 2195411..2195707 (-) | 297 | WP_001005282.1 | hypothetical protein | - |
| M1S25_RS10570 (M1S25_10570) | - | 2195768..2196001 (-) | 234 | WP_000414267.1 | hypothetical protein | - |
| M1S25_RS10575 (M1S25_10575) | - | 2196129..2196833 (+) | 705 | WP_000420592.1 | helix-turn-helix transcriptional regulator | - |
| M1S25_RS10580 (M1S25_10580) | - | 2197078..2197368 (+) | 291 | WP_001071964.1 | hypothetical protein | - |
| M1S25_RS10585 (M1S25_10585) | - | 2197371..2197787 (+) | 417 | WP_001260747.1 | hypothetical protein | - |
| M1S25_RS10590 (M1S25_10590) | - | 2198010..2198426 (+) | 417 | WP_047938247.1 | hypothetical protein | - |
| M1S25_RS10595 (M1S25_10595) | - | 2198436..2198996 (+) | 561 | WP_000739594.1 | hypothetical protein | - |
| M1S25_RS10600 (M1S25_10600) | - | 2199005..2199373 (+) | 369 | WP_000160440.1 | hypothetical protein | - |
| M1S25_RS10605 (M1S25_10605) | - | 2199373..2200143 (+) | 771 | Protein_2065 | BRO family protein | - |
| M1S25_RS10610 (M1S25_10610) | - | 2200140..2200391 (+) | 252 | WP_000141159.1 | hypothetical protein | - |
| M1S25_RS10615 (M1S25_10615) | - | 2200357..2201316 (-) | 960 | WP_000190202.1 | tyrosine-type recombinase/integrase | - |
| M1S25_RS10620 (M1S25_10620) | zapE | 2201493..2202635 (-) | 1143 | WP_000933387.1 | cell division protein ZapE | - |
| M1S25_RS10625 (M1S25_10625) | - | 2202719..2203738 (-) | 1020 | WP_000830356.1 | AraC family transcriptional regulator | - |
| M1S25_RS10630 (M1S25_10630) | - | 2203860..2205407 (+) | 1548 | WP_014538345.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| M1S25_RS10635 (M1S25_10635) | - | 2205457..2206368 (+) | 912 | WP_001190746.1 | lysine exporter LysO family protein | - |
| M1S25_RS10640 (M1S25_10640) | pyrF | 2206365..2207063 (-) | 699 | WP_000392928.1 | orotidine-5'-phosphate decarboxylase | - |
| M1S25_RS10645 (M1S25_10645) | - | 2207229..2207594 (-) | 366 | WP_001269278.1 | lipopolysaccharide assembly protein LapA domain-containing protein | - |
| M1S25_RS10650 (M1S25_10650) | - | 2207619..2207921 (-) | 303 | WP_000205997.1 | integration host factor subunit beta | - |
| M1S25_RS10655 (M1S25_10655) | rpsA | 2208078..2209751 (-) | 1674 | WP_000140309.1 | 30S ribosomal protein S1 | - |
| M1S25_RS10660 (M1S25_10660) | cmk | 2209856..2210542 (-) | 687 | WP_000218018.1 | (d)CMP kinase | - |
| M1S25_RS10665 (M1S25_10665) | - | 2210550..2210993 (-) | 444 | WP_001246675.1 | SRPBCC family protein | - |
| M1S25_RS10670 (M1S25_10670) | tadA | 2211063..2211566 (-) | 504 | WP_047938248.1 | tRNA adenosine(34) deaminase TadA | - |
| M1S25_RS10675 (M1S25_10675) | - | 2211573..2212697 (-) | 1125 | WP_001983908.1 | enoyl-CoA hydratase/isomerase family protein | - |
| M1S25_RS10680 (M1S25_10680) | ung | 2212694..2213407 (-) | 714 | WP_001177528.1 | uracil-DNA glycosylase | - |
| M1S25_RS10685 (M1S25_10685) | - | 2213458..2214054 (-) | 597 | WP_000908452.1 | 6-carboxytetrahydropterin synthase | - |
| M1S25_RS10690 (M1S25_10690) | gspK | 2214285..2215244 (-) | 960 | WP_000301476.1 | type II secretion system minor pseudopilin GspK | - |
| M1S25_RS10695 (M1S25_10695) | xcpW | 2215244..2215945 (-) | 702 | WP_000594589.1 | type II secretion system minor pseudopilin GspJ | Machinery gene |
| M1S25_RS10700 (M1S25_10700) | xcpV | 2215945..2216325 (-) | 381 | WP_000836911.1 | type II secretion system minor pseudopilin GspI | Machinery gene |
| M1S25_RS10705 (M1S25_10705) | - | 2216315..2216869 (-) | 555 | WP_000841373.1 | type II secretion system protein | - |
| M1S25_RS10710 (M1S25_10710) | - | 2216879..2217487 (-) | 609 | WP_000375838.1 | TetR/AcrR family transcriptional regulator | - |
| M1S25_RS10715 (M1S25_10715) | - | 2217525..2218298 (-) | 774 | WP_000497298.1 | TatD family hydrolase | - |
| M1S25_RS10720 (M1S25_10720) | - | 2218316..2218657 (-) | 342 | WP_001183024.1 | PilZ domain-containing protein | - |
| M1S25_RS10725 (M1S25_10725) | - | 2218669..2219649 (-) | 981 | WP_001075411.1 | DNA polymerase III subunit delta' | - |
| M1S25_RS10730 (M1S25_10730) | kdsB | 2219661..2220422 (-) | 762 | WP_000680697.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
| M1S25_RS10735 (M1S25_10735) | lpxK | 2220432..2221442 (-) | 1011 | WP_000050464.1 | tetraacyldisaccharide 4'-kinase | - |
| M1S25_RS10740 (M1S25_10740) | msbA | 2221445..2223172 (-) | 1728 | WP_001070734.1 | lipid A export permease/ATP-binding protein MsbA | - |
| M1S25_RS10745 (M1S25_10745) | - | 2223169..2223597 (-) | 429 | WP_000669684.1 | biopolymer transporter ExbD | - |
| M1S25_RS10750 (M1S25_10750) | - | 2223613..2224248 (-) | 636 | WP_000264037.1 | MotA/TolQ/ExbB proton channel family protein | - |
| M1S25_RS10755 (M1S25_10755) | - | 2224298..2225185 (-) | 888 | WP_000023433.1 | ParB/RepB/Spo0J family partition protein | - |
| M1S25_RS10760 (M1S25_10760) | - | 2225182..2225964 (-) | 783 | WP_000057212.1 | ParA family protein | - |
Sequence
Protein
Download Length: 126 a.a. Molecular weight: 13975.20 Da Isoelectric Point: 9.8004
>NTDB_id=683167 M1S25_RS10700 WP_000836911.1 2215945..2216325(-) (xcpV) [Acinetobacter baumannii strain 5736]
MKSKGFTLLEVMVALAIFAVAAVALTKVAMQYTQSTSNAILRTKAQFVAMNEVAMMEINQEWLQGTQSKQVTSQGETWQI
DKSAQSTISPNVQKIDLQVSLYDPDKGKVQNGITHMVFFNYPVKAK
MKSKGFTLLEVMVALAIFAVAAVALTKVAMQYTQSTSNAILRTKAQFVAMNEVAMMEINQEWLQGTQSKQVTSQGETWQI
DKSAQSTISPNVQKIDLQVSLYDPDKGKVQNGITHMVFFNYPVKAK
Nucleotide
Download Length: 381 bp
>NTDB_id=683167 M1S25_RS10700 WP_000836911.1 2215945..2216325(-) (xcpV) [Acinetobacter baumannii strain 5736]
ATGAAATCTAAAGGCTTTACCCTCTTAGAAGTTATGGTTGCTTTGGCAATCTTTGCAGTCGCAGCTGTCGCTTTAACTAA
AGTGGCAATGCAGTACACGCAGTCCACTTCAAATGCAATTTTGCGAACCAAAGCTCAATTTGTAGCAATGAATGAAGTTG
CTATGATGGAGATTAATCAAGAATGGTTGCAAGGAACCCAGAGTAAGCAAGTAACTTCCCAAGGTGAAACTTGGCAAATT
GATAAGTCAGCTCAATCTACTATTAGCCCGAATGTTCAAAAAATTGATTTACAAGTGAGTTTGTATGATCCGGATAAGGG
AAAAGTACAAAATGGCATTACTCATATGGTCTTTTTTAATTATCCAGTGAAAGCAAAATAA
ATGAAATCTAAAGGCTTTACCCTCTTAGAAGTTATGGTTGCTTTGGCAATCTTTGCAGTCGCAGCTGTCGCTTTAACTAA
AGTGGCAATGCAGTACACGCAGTCCACTTCAAATGCAATTTTGCGAACCAAAGCTCAATTTGTAGCAATGAATGAAGTTG
CTATGATGGAGATTAATCAAGAATGGTTGCAAGGAACCCAGAGTAAGCAAGTAACTTCCCAAGGTGAAACTTGGCAAATT
GATAAGTCAGCTCAATCTACTATTAGCCCGAATGTTCAAAAAATTGATTTACAAGTGAGTTTGTATGATCCGGATAAGGG
AAAAGTACAAAATGGCATTACTCATATGGTCTTTTTTAATTATCCAGTGAAAGCAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| xcpV | Acinetobacter baumannii D1279779 |
100 |
100 |
1 |