Detailed information    

insolico Bioinformatically predicted

Overview

Name   xcpW   Type   Machinery gene
Locus tag   M1S25_RS10695 Genome accession   NZ_CP096722
Coordinates   2215244..2215945 (-) Length   233 a.a.
NCBI ID   WP_000594589.1    Uniprot ID   A0A9P3CZ31
Organism   Acinetobacter baumannii strain 5736     
Function   pseudopilus assembly (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2166954..2225964 2215244..2215945 within 0


Gene organization within MGE regions


Location: 2166954..2225964
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M1S25_RS10360 (M1S25_10360) - 2166954..2167463 (-) 510 WP_000095892.1 lysozyme -
  M1S25_RS10365 (M1S25_10365) - 2167447..2167713 (-) 267 WP_000774828.1 holin -
  M1S25_RS10370 (M1S25_10370) - 2167788..2168012 (-) 225 WP_001104854.1 hypothetical protein -
  M1S25_RS10375 (M1S25_10375) - 2168014..2170050 (-) 2037 WP_002018761.1 hypothetical protein -
  M1S25_RS10380 (M1S25_10380) - 2170104..2172939 (-) 2836 Protein_2019 host specificity factor TipJ family phage tail protein -
  M1S25_RS10385 (M1S25_10385) - 2172890..2173285 (-) 396 WP_236753102.1 hypothetical protein -
  M1S25_RS10390 (M1S25_10390) - 2173282..2173791 (-) 510 WP_000587324.1 DUF1833 family protein -
  M1S25_RS10395 (M1S25_10395) - 2173794..2174255 (-) 462 WP_000882463.1 hypothetical protein -
  M1S25_RS10400 (M1S25_10400) - 2174271..2177867 (-) 3597 WP_047938240.1 transglycosylase SLT domain-containing protein -
  M1S25_RS10405 (M1S25_10405) - 2177973..2178206 (-) 234 WP_249370374.1 hypothetical protein -
  M1S25_RS10410 (M1S25_10410) - 2178350..2178565 (-) 216 WP_031978725.1 hypothetical protein -
  M1S25_RS10415 (M1S25_10415) - 2178601..2179116 (-) 516 WP_236753104.1 phage tail assembly chaperone family protein, TAC -
  M1S25_RS10420 (M1S25_10420) - 2179118..2179594 (-) 477 WP_001062223.1 phage tail tube protein -
  M1S25_RS10425 (M1S25_10425) - 2179666..2180040 (-) 375 WP_000598741.1 DUF3168 domain-containing protein -
  M1S25_RS10430 (M1S25_10430) - 2180040..2180525 (-) 486 WP_000235306.1 HK97-gp10 family putative phage morphogenesis protein -
  M1S25_RS10435 (M1S25_10435) - 2180529..2180885 (-) 357 WP_001139340.1 phage head closure protein -
  M1S25_RS10440 (M1S25_10440) - 2180887..2181174 (-) 288 WP_000631202.1 head-tail connector protein -
  M1S25_RS10445 (M1S25_10445) - 2181171..2181347 (-) 177 WP_000666093.1 hypothetical protein -
  M1S25_RS10450 (M1S25_10450) - 2181395..2182567 (-) 1173 WP_000137059.1 phage major capsid protein -
  M1S25_RS10455 (M1S25_10455) - 2182560..2183222 (-) 663 WP_000375469.1 HK97 family phage prohead protease -
  M1S25_RS10460 (M1S25_10460) - 2183215..2184441 (-) 1227 WP_000108390.1 phage portal protein -
  M1S25_RS10465 (M1S25_10465) - 2184438..2186132 (-) 1695 WP_000125540.1 terminase large subunit -
  M1S25_RS10470 (M1S25_10470) - 2186304..2186495 (-) 192 WP_001191044.1 hypothetical protein -
  M1S25_RS10475 (M1S25_10475) - 2186515..2186997 (-) 483 WP_001219090.1 terminase small subunit -
  M1S25_RS10480 (M1S25_10480) - 2186988..2187146 (-) 159 WP_166739911.1 hypothetical protein -
  M1S25_RS10485 (M1S25_10485) - 2187158..2187370 (-) 213 WP_038338979.1 hypothetical protein -
  M1S25_RS10490 (M1S25_10490) - 2187367..2187666 (-) 300 WP_000776297.1 HNH endonuclease -
  M1S25_RS10495 (M1S25_10495) - 2187596..2187886 (-) 291 WP_017724759.1 hypothetical protein -
  M1S25_RS10500 (M1S25_10500) - 2187864..2188421 (-) 558 WP_017724760.1 hypothetical protein -
  M1S25_RS10505 (M1S25_10505) - 2188530..2188763 (-) 234 WP_249370375.1 hypothetical protein -
  M1S25_RS10510 (M1S25_10510) - 2188768..2188992 (-) 225 WP_134232931.1 hypothetical protein -
  M1S25_RS10515 (M1S25_10515) - 2188982..2189512 (-) 531 WP_134232932.1 hypothetical protein -
  M1S25_RS10520 (M1S25_10520) - 2189528..2189926 (-) 399 WP_134232933.1 hypothetical protein -
  M1S25_RS10525 (M1S25_10525) - 2190002..2190220 (-) 219 WP_000238616.1 hypothetical protein -
  M1S25_RS20450 - 2190415..2190549 (+) 135 WP_017724763.1 hypothetical protein -
  M1S25_RS10535 (M1S25_10535) - 2190677..2190907 (-) 231 WP_017724764.1 hypothetical protein -
  M1S25_RS10540 (M1S25_10540) - 2191198..2192094 (-) 897 WP_134232934.1 hypothetical protein -
  M1S25_RS10545 (M1S25_10545) - 2192160..2192633 (-) 474 WP_002000320.1 hypothetical protein -
  M1S25_RS10550 (M1S25_10550) - 2192660..2192938 (-) 279 WP_000847048.1 hypothetical protein -
  M1S25_RS20400 - 2192935..2193456 (-) 522 WP_346731800.1 DnaB-like helicase C-terminal domain-containing protein -
  M1S25_RS20405 - 2193554..2194345 (-) 792 WP_283253749.1 DnaB-like helicase C-terminal domain-containing protein -
  M1S25_RS10560 (M1S25_10560) - 2194342..2195313 (-) 972 WP_249370376.1 YdaU family protein -
  M1S25_RS10565 (M1S25_10565) - 2195411..2195707 (-) 297 WP_001005282.1 hypothetical protein -
  M1S25_RS10570 (M1S25_10570) - 2195768..2196001 (-) 234 WP_000414267.1 hypothetical protein -
  M1S25_RS10575 (M1S25_10575) - 2196129..2196833 (+) 705 WP_000420592.1 helix-turn-helix transcriptional regulator -
  M1S25_RS10580 (M1S25_10580) - 2197078..2197368 (+) 291 WP_001071964.1 hypothetical protein -
  M1S25_RS10585 (M1S25_10585) - 2197371..2197787 (+) 417 WP_001260747.1 hypothetical protein -
  M1S25_RS10590 (M1S25_10590) - 2198010..2198426 (+) 417 WP_047938247.1 hypothetical protein -
  M1S25_RS10595 (M1S25_10595) - 2198436..2198996 (+) 561 WP_000739594.1 hypothetical protein -
  M1S25_RS10600 (M1S25_10600) - 2199005..2199373 (+) 369 WP_000160440.1 hypothetical protein -
  M1S25_RS10605 (M1S25_10605) - 2199373..2200143 (+) 771 Protein_2065 BRO family protein -
  M1S25_RS10610 (M1S25_10610) - 2200140..2200391 (+) 252 WP_000141159.1 hypothetical protein -
  M1S25_RS10615 (M1S25_10615) - 2200357..2201316 (-) 960 WP_000190202.1 tyrosine-type recombinase/integrase -
  M1S25_RS10620 (M1S25_10620) zapE 2201493..2202635 (-) 1143 WP_000933387.1 cell division protein ZapE -
  M1S25_RS10625 (M1S25_10625) - 2202719..2203738 (-) 1020 WP_000830356.1 AraC family transcriptional regulator -
  M1S25_RS10630 (M1S25_10630) - 2203860..2205407 (+) 1548 WP_014538345.1 NAD(P)/FAD-dependent oxidoreductase -
  M1S25_RS10635 (M1S25_10635) - 2205457..2206368 (+) 912 WP_001190746.1 lysine exporter LysO family protein -
  M1S25_RS10640 (M1S25_10640) pyrF 2206365..2207063 (-) 699 WP_000392928.1 orotidine-5'-phosphate decarboxylase -
  M1S25_RS10645 (M1S25_10645) - 2207229..2207594 (-) 366 WP_001269278.1 lipopolysaccharide assembly protein LapA domain-containing protein -
  M1S25_RS10650 (M1S25_10650) - 2207619..2207921 (-) 303 WP_000205997.1 integration host factor subunit beta -
  M1S25_RS10655 (M1S25_10655) rpsA 2208078..2209751 (-) 1674 WP_000140309.1 30S ribosomal protein S1 -
  M1S25_RS10660 (M1S25_10660) cmk 2209856..2210542 (-) 687 WP_000218018.1 (d)CMP kinase -
  M1S25_RS10665 (M1S25_10665) - 2210550..2210993 (-) 444 WP_001246675.1 SRPBCC family protein -
  M1S25_RS10670 (M1S25_10670) tadA 2211063..2211566 (-) 504 WP_047938248.1 tRNA adenosine(34) deaminase TadA -
  M1S25_RS10675 (M1S25_10675) - 2211573..2212697 (-) 1125 WP_001983908.1 enoyl-CoA hydratase/isomerase family protein -
  M1S25_RS10680 (M1S25_10680) ung 2212694..2213407 (-) 714 WP_001177528.1 uracil-DNA glycosylase -
  M1S25_RS10685 (M1S25_10685) - 2213458..2214054 (-) 597 WP_000908452.1 6-carboxytetrahydropterin synthase -
  M1S25_RS10690 (M1S25_10690) gspK 2214285..2215244 (-) 960 WP_000301476.1 type II secretion system minor pseudopilin GspK -
  M1S25_RS10695 (M1S25_10695) xcpW 2215244..2215945 (-) 702 WP_000594589.1 type II secretion system minor pseudopilin GspJ Machinery gene
  M1S25_RS10700 (M1S25_10700) xcpV 2215945..2216325 (-) 381 WP_000836911.1 type II secretion system minor pseudopilin GspI Machinery gene
  M1S25_RS10705 (M1S25_10705) - 2216315..2216869 (-) 555 WP_000841373.1 type II secretion system protein -
  M1S25_RS10710 (M1S25_10710) - 2216879..2217487 (-) 609 WP_000375838.1 TetR/AcrR family transcriptional regulator -
  M1S25_RS10715 (M1S25_10715) - 2217525..2218298 (-) 774 WP_000497298.1 TatD family hydrolase -
  M1S25_RS10720 (M1S25_10720) - 2218316..2218657 (-) 342 WP_001183024.1 PilZ domain-containing protein -
  M1S25_RS10725 (M1S25_10725) - 2218669..2219649 (-) 981 WP_001075411.1 DNA polymerase III subunit delta' -
  M1S25_RS10730 (M1S25_10730) kdsB 2219661..2220422 (-) 762 WP_000680697.1 3-deoxy-manno-octulosonate cytidylyltransferase -
  M1S25_RS10735 (M1S25_10735) lpxK 2220432..2221442 (-) 1011 WP_000050464.1 tetraacyldisaccharide 4'-kinase -
  M1S25_RS10740 (M1S25_10740) msbA 2221445..2223172 (-) 1728 WP_001070734.1 lipid A export permease/ATP-binding protein MsbA -
  M1S25_RS10745 (M1S25_10745) - 2223169..2223597 (-) 429 WP_000669684.1 biopolymer transporter ExbD -
  M1S25_RS10750 (M1S25_10750) - 2223613..2224248 (-) 636 WP_000264037.1 MotA/TolQ/ExbB proton channel family protein -
  M1S25_RS10755 (M1S25_10755) - 2224298..2225185 (-) 888 WP_000023433.1 ParB/RepB/Spo0J family partition protein -
  M1S25_RS10760 (M1S25_10760) - 2225182..2225964 (-) 783 WP_000057212.1 ParA family protein -

Sequence

Protein


Download         Length: 233 a.a.        Molecular weight: 26639.58 Da        Isoelectric Point: 9.3468

>NTDB_id=683166 M1S25_RS10695 WP_000594589.1 2215244..2215945(-) (xcpW) [Acinetobacter baumannii strain 5736]
MIKNKYIHIRSIDSRLAARSSSARLTRASGFTLVELLVAIAIFAVLSLLGWKIFDYLLKVRDRNAEHEVHLFELQDAYQQ
ILRDTLQIIPLSANQGGQLHPALEIDNQILRFSKAGVTDPLKQGLSPFERIEYRYDADQKKLYRLKYTNLNTSNREQPLS
STLLSQVDQYQIMVLTPQEVTKWPEVNIDPTKPNELKKLPKGIKIQLTVAGVNYEWIYSLNQGDLSLSQEGNS

Nucleotide


Download         Length: 702 bp        

>NTDB_id=683166 M1S25_RS10695 WP_000594589.1 2215244..2215945(-) (xcpW) [Acinetobacter baumannii strain 5736]
ATGATAAAAAATAAATATATTCACATCCGAAGCATTGATTCTCGCCTTGCAGCACGATCGAGCAGTGCTCGATTAACTCG
CGCCTCAGGATTTACTTTGGTTGAATTGTTAGTCGCGATCGCTATCTTTGCGGTTTTATCTTTATTGGGGTGGAAAATTT
TCGATTACTTGCTCAAAGTTCGTGATCGTAATGCCGAACATGAAGTGCATTTATTTGAATTACAAGATGCTTATCAACAA
ATTCTTCGTGATACTTTGCAGATTATCCCTTTATCCGCAAACCAAGGTGGTCAACTTCATCCAGCTTTAGAAATCGATAA
TCAAATTTTACGTTTTAGCAAAGCAGGCGTAACGGATCCTTTAAAACAAGGCTTATCACCATTTGAACGAATTGAATATC
GTTATGATGCAGACCAAAAAAAATTATATCGTCTTAAATATACAAATTTGAATACTTCGAACAGAGAGCAACCTTTATCG
AGTACTTTGTTAAGTCAAGTCGACCAATATCAGATTATGGTTTTGACTCCGCAAGAAGTCACAAAATGGCCCGAGGTTAA
TATTGATCCAACGAAACCTAATGAGTTAAAAAAATTACCGAAAGGGATAAAAATCCAACTTACAGTCGCTGGTGTAAATT
ATGAGTGGATTTATAGCTTAAATCAGGGTGACTTATCGCTTTCGCAGGAAGGTAATTCATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(27-49)

Type II secretion system (T2SS), protein J (T2SSJ)

(83-212)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  xcpW Acinetobacter baumannii D1279779

99.571

100

0.996