Detailed information    

experimental Experimentally validated

Overview


Name   xcpV   Type   Machinery gene
Locus tag   ABD1_RS08070 Genome accession   NC_020547
Coordinates   1680858..1681238 (+) Length   126 a.a.
NCBI ID   WP_000836911.1    Uniprot ID   -
Organism   Acinetobacter baumannii D1279779     
Function   pseudopilus assembly   
DNA binding and uptake

Function


We examined the 33 knockout mutants by comparing their transformation efficiency with wild-type W068. No knockout strains were affected in growth, but 28 of these mutants were severely or completely impaired in natural transformability. These mutations were in 18 genes related to T4P (pilF, pilQ, tsaP, pilM, pilN, pilO, pilP, pilB, pilC, pilT, pilD, pilE, pilY2, pilY1, pilX, pilW, pilV, and fimU), six genes related to DNA uptake and processing (comEA, comA, comF, priA, dprA, and recA), two genes related to T2SS (xcpV and xcpW), and the crp and tonB2 genes.


Genomic Context


Location: 1675858..1686238
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABD1_RS08040 (ABD1_15660) kdsB 1676761..1677522 (+) 762 WP_000680700.1 3-deoxy-manno-octulosonate cytidylyltransferase -
  ABD1_RS08045 (ABD1_15670) - 1677534..1678514 (+) 981 WP_043960937.1 DNA polymerase III subunit delta' -
  ABD1_RS08050 (ABD1_15680) - 1678526..1678867 (+) 342 WP_001183024.1 PilZ domain-containing protein -
  ABD1_RS08055 (ABD1_15690) - 1678885..1679658 (+) 774 WP_000497298.1 TatD family hydrolase -
  ABD1_RS08060 (ABD1_15700) - 1679696..1680304 (+) 609 WP_000375838.1 TetR/AcrR family transcriptional regulator -
  ABD1_RS08065 (ABD1_15710) - 1680314..1680868 (+) 555 WP_004841361.1 type II secretion system protein -
  ABD1_RS08070 (ABD1_15720) xcpV 1680858..1681238 (+) 381 WP_000836911.1 type II secretion system minor pseudopilin GspI Machinery gene
  ABD1_RS08075 (ABD1_15730) xcpW 1681238..1681939 (+) 702 WP_000594585.1 type II secretion system minor pseudopilin GspJ Machinery gene
  ABD1_RS08080 (ABD1_15740) gspK 1681939..1682898 (+) 960 WP_000301468.1 type II secretion system minor pseudopilin GspK -
  ABD1_RS08085 (ABD1_15750) - 1683128..1683724 (+) 597 WP_000908453.1 6-pyruvoyl trahydropterin synthase family protein -
  ABD1_RS08090 (ABD1_15760) ung 1683775..1684488 (+) 714 WP_001177528.1 uracil-DNA glycosylase -
  ABD1_RS08095 (ABD1_15770) - 1684485..1685609 (+) 1125 WP_001983908.1 enoyl-CoA hydratase/isomerase family protein -
  ABD1_RS08100 (ABD1_15780) tadA 1685616..1686119 (+) 504 WP_001997771.1 tRNA adenosine(34) deaminase TadA -

Sequence


Protein


Download         Length: 126 a.a.        Molecular weight: 13975.20 Da        Isoelectric Point: 9.8004

>NTDB_id=1075 ABD1_RS08070 WP_000836911.1 1680858..1681238(+) (xcpV) [Acinetobacter baumannii D1279779]
MKSKGFTLLEVMVALAIFAVAAVALTKVAMQYTQSTSNAILRTKAQFVAMNEVAMMEINQEWLQGTQSKQVTSQGETWQI
DKSAQSTISPNVQKIDLQVSLYDPDKGKVQNGITHMVFFNYPVKAK

Nucleotide


Download         Length: 381 bp        

>NTDB_id=1075 ABD1_RS08070 WP_000836911.1 1680858..1681238(+) (xcpV) [Acinetobacter baumannii D1279779]
ATGAAATCTAAAGGCTTTACCCTCTTAGAAGTTATGGTTGCTTTGGCAATCTTTGCAGTCGCAGCTGTCGCTTTAACTAA
AGTGGCAATGCAGTACACGCAGTCCACTTCAAATGCAATTTTGCGAACCAAAGCTCAGTTTGTGGCAATGAATGAAGTTG
CTATGATGGAGATTAATCAAGAATGGTTGCAAGGAACTCAAAGTAAGCAGGTAACTTCCCAAGGTGAAACTTGGCAAATT
GATAAGTCAGCTCAATCTACAATTAGCCCAAATGTTCAAAAAATTGATTTACAAGTGAGTTTGTATGATCCGGATAAGGG
AAAAGTACAAAATGGCATTACTCATATGGTTTTTTTTAATTATCCAGTGAAAGCAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Yuan Hu et al. (2021) Natural Transformation in Acinetobacter baumannii W068: A Genetic Analysis Reveals the Involvements of the CRP, XcpV, XcpW, TsaP, and TonB2. Frontiers in Microbiology 12:738034. [PMID: 35126321]