Detailed information
Overview
| Name | xcpV | Type | Machinery gene |
| Locus tag | ABD1_RS08070 | Genome accession | NC_020547 |
| Coordinates | 1680858..1681238 (+) | Length | 126 a.a. |
| NCBI ID | WP_000836911.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii D1279779 | ||
| Function | pseudopilus assembly DNA binding and uptake |
||
Function
We examined the 33 knockout mutants by comparing their transformation efficiency with wild-type W068. No knockout strains were affected in growth, but 28 of these mutants were severely or completely impaired in natural transformability. These mutations were in 18 genes related to T4P (pilF, pilQ, tsaP, pilM, pilN, pilO, pilP, pilB, pilC, pilT, pilD, pilE, pilY2, pilY1, pilX, pilW, pilV, and fimU), six genes related to DNA uptake and processing (comEA, comA, comF, priA, dprA, and recA), two genes related to T2SS (xcpV and xcpW), and the crp and tonB2 genes.
Genomic Context
Location: 1675858..1686238
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD1_RS08040 (ABD1_15660) | kdsB | 1676761..1677522 (+) | 762 | WP_000680700.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
| ABD1_RS08045 (ABD1_15670) | - | 1677534..1678514 (+) | 981 | WP_043960937.1 | DNA polymerase III subunit delta' | - |
| ABD1_RS08050 (ABD1_15680) | - | 1678526..1678867 (+) | 342 | WP_001183024.1 | PilZ domain-containing protein | - |
| ABD1_RS08055 (ABD1_15690) | - | 1678885..1679658 (+) | 774 | WP_000497298.1 | TatD family hydrolase | - |
| ABD1_RS08060 (ABD1_15700) | - | 1679696..1680304 (+) | 609 | WP_000375838.1 | TetR/AcrR family transcriptional regulator | - |
| ABD1_RS08065 (ABD1_15710) | - | 1680314..1680868 (+) | 555 | WP_004841361.1 | type II secretion system protein | - |
| ABD1_RS08070 (ABD1_15720) | xcpV | 1680858..1681238 (+) | 381 | WP_000836911.1 | type II secretion system minor pseudopilin GspI | Machinery gene |
| ABD1_RS08075 (ABD1_15730) | xcpW | 1681238..1681939 (+) | 702 | WP_000594585.1 | type II secretion system minor pseudopilin GspJ | Machinery gene |
| ABD1_RS08080 (ABD1_15740) | gspK | 1681939..1682898 (+) | 960 | WP_000301468.1 | type II secretion system minor pseudopilin GspK | - |
| ABD1_RS08085 (ABD1_15750) | - | 1683128..1683724 (+) | 597 | WP_000908453.1 | 6-pyruvoyl trahydropterin synthase family protein | - |
| ABD1_RS08090 (ABD1_15760) | ung | 1683775..1684488 (+) | 714 | WP_001177528.1 | uracil-DNA glycosylase | - |
| ABD1_RS08095 (ABD1_15770) | - | 1684485..1685609 (+) | 1125 | WP_001983908.1 | enoyl-CoA hydratase/isomerase family protein | - |
| ABD1_RS08100 (ABD1_15780) | tadA | 1685616..1686119 (+) | 504 | WP_001997771.1 | tRNA adenosine(34) deaminase TadA | - |
Sequence
Protein
Download Length: 126 a.a. Molecular weight: 13975.20 Da Isoelectric Point: 9.8004
MKSKGFTLLEVMVALAIFAVAAVALTKVAMQYTQSTSNAILRTKAQFVAMNEVAMMEINQEWLQGTQSKQVTSQGETWQI
DKSAQSTISPNVQKIDLQVSLYDPDKGKVQNGITHMVFFNYPVKAK
Nucleotide
Download Length: 381 bp
ATGAAATCTAAAGGCTTTACCCTCTTAGAAGTTATGGTTGCTTTGGCAATCTTTGCAGTCGCAGCTGTCGCTTTAACTAA
AGTGGCAATGCAGTACACGCAGTCCACTTCAAATGCAATTTTGCGAACCAAAGCTCAGTTTGTGGCAATGAATGAAGTTG
CTATGATGGAGATTAATCAAGAATGGTTGCAAGGAACTCAAAGTAAGCAGGTAACTTCCCAAGGTGAAACTTGGCAAATT
GATAAGTCAGCTCAATCTACAATTAGCCCAAATGTTCAAAAAATTGATTTACAAGTGAGTTTGTATGATCCGGATAAGGG
AAAAGTACAAAATGGCATTACTCATATGGTTTTTTTTAATTATCCAGTGAAAGCAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Yuan Hu et al. (2021) Natural Transformation in Acinetobacter baumannii W068: A Genetic Analysis Reveals the Involvements of the CRP, XcpV, XcpW, TsaP, and TonB2. Frontiers in Microbiology 12:738034. [PMID: 35126321] |