Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M0696_RS15975 Genome accession   NZ_CP096590
Coordinates   3134627..3134767 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus rugosus strain A78.1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3129627..3139767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M0696_RS15950 (M0696_15950) - 3129969..3130349 (-) 381 WP_248602148.1 hotdog fold thioesterase -
  M0696_RS15955 (M0696_15955) comA 3130369..3131013 (-) 645 WP_166848873.1 two-component system response regulator ComA Regulator
  M0696_RS15960 (M0696_15960) - 3131094..3133393 (-) 2300 Protein_3084 histidine kinase -
  M0696_RS15965 (M0696_15965) comX 3133405..3133569 (-) 165 WP_015384519.1 competence pheromone ComX -
  M0696_RS15970 (M0696_15970) - 3133582..3134442 (-) 861 WP_248602149.1 polyprenyl synthetase family protein -
  M0696_RS15975 (M0696_15975) degQ 3134627..3134767 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  M0696_RS15980 (M0696_15980) - 3134989..3135051 (+) 63 Protein_3088 hypothetical protein -
  M0696_RS15985 (M0696_15985) - 3135228..3135596 (+) 369 WP_166848863.1 hypothetical protein -
  M0696_RS15990 (M0696_15990) pdeH 3135572..3136801 (-) 1230 WP_248602150.1 cyclic di-GMP phosphodiesterase -
  M0696_RS15995 (M0696_15995) - 3136938..3138410 (-) 1473 WP_014114988.1 nicotinate phosphoribosyltransferase -
  M0696_RS16000 (M0696_16000) - 3138426..3138977 (-) 552 WP_166848857.1 isochorismatase family cysteine hydrolase -
  M0696_RS16005 (M0696_16005) - 3139074..3139472 (-) 399 WP_166848854.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=681980 M0696_RS15975 WP_003220708.1 3134627..3134767(-) (degQ) [Bacillus rugosus strain A78.1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=681980 M0696_RS15975 WP_003220708.1 3134627..3134767(-) (degQ) [Bacillus rugosus strain A78.1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1