Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   M0696_RS12245 Genome accession   NZ_CP096590
Coordinates   2440477..2440824 (-) Length   115 a.a.
NCBI ID   WP_166850846.1    Uniprot ID   -
Organism   Bacillus rugosus strain A78.1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435477..2445824
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M0696_RS12200 (M0696_12200) sinI 2436006..2436179 (+) 174 WP_166850897.1 anti-repressor SinI family protein Regulator
  M0696_RS12205 (M0696_12205) sinR 2436213..2436548 (+) 336 WP_166850894.1 transcriptional regulator SinR Regulator
  M0696_RS12210 (M0696_12210) tasA 2436640..2437425 (-) 786 WP_166850876.1 biofilm matrix protein TasA -
  M0696_RS12215 (M0696_12215) - 2437489..2438061 (-) 573 WP_166854631.1 signal peptidase I -
  M0696_RS12220 (M0696_12220) tapA 2438045..2438803 (-) 759 WP_248601999.1 amyloid fiber anchoring/assembly protein TapA -
  M0696_RS12225 (M0696_12225) - 2439074..2439400 (+) 327 WP_222143412.1 YqzG/YhdC family protein -
  M0696_RS12230 (M0696_12230) - 2439443..2439622 (-) 180 WP_166850851.1 YqzE family protein -
  M0696_RS12235 (M0696_12235) comGG 2439693..2440067 (-) 375 WP_166850848.1 competence type IV pilus minor pilin ComGG Machinery gene
  M0696_RS12240 (M0696_12240) comGF 2440068..2440451 (-) 384 WP_248602000.1 competence type IV pilus minor pilin ComGF Machinery gene
  M0696_RS12245 (M0696_12245) comGE 2440477..2440824 (-) 348 WP_166850846.1 competence type IV pilus minor pilin ComGE Machinery gene
  M0696_RS12250 (M0696_12250) comGD 2440808..2441239 (-) 432 WP_166850843.1 competence type IV pilus minor pilin ComGD Machinery gene
  M0696_RS12255 (M0696_12255) comGC 2441229..2441525 (-) 297 WP_166850840.1 comG operon protein ComGC Machinery gene
  M0696_RS12260 (M0696_12260) comGB 2441539..2442576 (-) 1038 WP_222143154.1 competence type IV pilus assembly protein ComGB Machinery gene
  M0696_RS12265 (M0696_12265) comGA 2442563..2443633 (-) 1071 WP_166850818.1 competence protein ComGA Machinery gene
  M0696_RS12270 (M0696_12270) - 2443846..2444256 (-) 411 WP_222143155.1 CBS domain-containing protein -
  M0696_RS12275 (M0696_12275) - 2444319..2445266 (-) 948 WP_222143156.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13485.40 Da        Isoelectric Point: 4.4356

>NTDB_id=681961 M0696_RS12245 WP_166850846.1 2440477..2440824(-) (comGE) [Bacillus rugosus strain A78.1]
MWRENKGFSTIETMSALSLWLFLLLTVVPLWNKLIADENMAESREIGYQMMNESISKYMMTGEGTEEKTVTTNNNNYTLK
WEEEREYQNVCISAAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=681961 M0696_RS12245 WP_166850846.1 2440477..2440824(-) (comGE) [Bacillus rugosus strain A78.1]
ATGTGGAGAGAAAATAAAGGTTTTTCAACAATAGAAACAATGTCTGCGCTAAGTCTATGGCTGTTTCTGCTGCTGACAGT
CGTTCCATTGTGGAACAAGCTGATAGCTGATGAAAATATGGCGGAATCTCGAGAAATAGGCTACCAGATGATGAATGAAA
GCATTAGCAAATATATGATGACAGGTGAAGGAACTGAGGAAAAAACGGTTACGACTAACAATAATAACTATACGCTAAAG
TGGGAGGAGGAGCGGGAATATCAAAACGTATGCATCTCAGCAGCAGCTTATAAAGAAAAACCATTTTGCCTCAGCATTCT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

81.739

100

0.817