Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M0696_RS12200 Genome accession   NZ_CP096590
Coordinates   2436006..2436179 (+) Length   57 a.a.
NCBI ID   WP_166850897.1    Uniprot ID   -
Organism   Bacillus rugosus strain A78.1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2431006..2441179
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M0696_RS12185 (M0696_12185) gcvT 2431804..2432892 (-) 1089 WP_222143149.1 glycine cleavage system aminomethyltransferase GcvT -
  M0696_RS12190 (M0696_12190) - 2433333..2435006 (+) 1674 WP_222143150.1 SNF2-related protein -
  M0696_RS12195 (M0696_12195) - 2435027..2435821 (+) 795 WP_222143151.1 YqhG family protein -
  M0696_RS12200 (M0696_12200) sinI 2436006..2436179 (+) 174 WP_166850897.1 anti-repressor SinI family protein Regulator
  M0696_RS12205 (M0696_12205) sinR 2436213..2436548 (+) 336 WP_166850894.1 transcriptional regulator SinR Regulator
  M0696_RS12210 (M0696_12210) tasA 2436640..2437425 (-) 786 WP_166850876.1 biofilm matrix protein TasA -
  M0696_RS12215 (M0696_12215) - 2437489..2438061 (-) 573 WP_166854631.1 signal peptidase I -
  M0696_RS12220 (M0696_12220) tapA 2438045..2438803 (-) 759 WP_248601999.1 amyloid fiber anchoring/assembly protein TapA -
  M0696_RS12225 (M0696_12225) - 2439074..2439400 (+) 327 WP_222143412.1 YqzG/YhdC family protein -
  M0696_RS12230 (M0696_12230) - 2439443..2439622 (-) 180 WP_166850851.1 YqzE family protein -
  M0696_RS12235 (M0696_12235) comGG 2439693..2440067 (-) 375 WP_166850848.1 competence type IV pilus minor pilin ComGG Machinery gene
  M0696_RS12240 (M0696_12240) comGF 2440068..2440451 (-) 384 WP_248602000.1 competence type IV pilus minor pilin ComGF Machinery gene
  M0696_RS12245 (M0696_12245) comGE 2440477..2440824 (-) 348 WP_166850846.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.67 Da        Isoelectric Point: 8.5630

>NTDB_id=681957 M0696_RS12200 WP_166850897.1 2436006..2436179(+) (sinI) [Bacillus rugosus strain A78.1]
MKNAKQEYFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=681957 M0696_RS12200 WP_166850897.1 2436006..2436179(+) (sinI) [Bacillus rugosus strain A78.1]
ATGAAAAATGCAAAACAAGAGTACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

94.737

100

0.947