Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MX663_RS17140 Genome accession   NZ_CP095736
Coordinates   3246400..3246540 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3241400..3251540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MX663_RS17115 (MX663_17115) yuxO 3241742..3242122 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  MX663_RS17120 (MX663_17120) comA 3242141..3242785 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MX663_RS17125 (MX663_17125) comP 3242866..3245166 (-) 2301 WP_088300729.1 histidine kinase Regulator
  MX663_RS17130 (MX663_17130) comX 3245178..3245342 (-) 165 WP_015384519.1 competence pheromone ComX -
  MX663_RS17135 (MX663_17135) - 3245355..3246215 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  MX663_RS17140 (MX663_17140) degQ 3246400..3246540 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MX663_RS17145 (MX663_17145) - 3246762..3246887 (+) 126 WP_003228793.1 hypothetical protein -
  MX663_RS17150 (MX663_17150) - 3247001..3247369 (+) 369 WP_014477834.1 hypothetical protein -
  MX663_RS17155 (MX663_17155) pdeH 3247345..3248574 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MX663_RS17160 (MX663_17160) pncB 3248711..3250183 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MX663_RS17165 (MX663_17165) pncA 3250199..3250750 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  MX663_RS17170 (MX663_17170) yueI 3250847..3251245 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=677888 MX663_RS17140 WP_003220708.1 3246400..3246540(-) (degQ) [Bacillus subtilis strain N4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=677888 MX663_RS17140 WP_003220708.1 3246400..3246540(-) (degQ) [Bacillus subtilis strain N4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1