Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   MUW37_RS07560 Genome accession   NZ_CP095090
Coordinates   1612631..1613503 (-) Length   290 a.a.
NCBI ID   WP_001829468.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain SKN25lux     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1574172..1645047 1612631..1613503 within 0


Gene organization within MGE regions


Location: 1574172..1645047
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUW37_RS07415 (MUW37_07415) - 1575212..1576483 (-) 1272 WP_002439538.1 pitrilysin family protein -
  MUW37_RS07420 (MUW37_07420) - 1576514..1577227 (-) 714 WP_002439536.1 GntR family transcriptional regulator -
  MUW37_RS07425 (MUW37_07425) - 1577230..1579623 (-) 2394 WP_002439534.1 DNA translocase FtsK -
  MUW37_RS07430 (MUW37_07430) - 1579889..1581562 (-) 1674 WP_002457357.1 ribonuclease J -
  MUW37_RS07435 (MUW37_07435) pnp 1581930..1584035 (-) 2106 WP_001832554.1 polyribonucleotide nucleotidyltransferase -
  MUW37_RS07440 (MUW37_07440) rpsO 1584167..1584436 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  MUW37_RS07445 (MUW37_07445) - 1584556..1585527 (-) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  MUW37_RS07450 (MUW37_07450) truB 1585543..1586460 (-) 918 WP_002456563.1 tRNA pseudouridine(55) synthase TruB -
  MUW37_RS07455 (MUW37_07455) rbfA 1586598..1586948 (-) 351 WP_001829509.1 30S ribosome-binding factor RbfA -
  MUW37_RS07460 (MUW37_07460) infB 1587251..1589413 (-) 2163 WP_002468903.1 translation initiation factor IF-2 -
  MUW37_RS07465 (MUW37_07465) - 1589418..1589735 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  MUW37_RS07470 (MUW37_07470) - 1589735..1590019 (-) 285 WP_001829465.1 YlxR family protein -
  MUW37_RS07475 (MUW37_07475) nusA 1590037..1591260 (-) 1224 WP_002456565.1 transcription termination factor NusA -
  MUW37_RS07480 (MUW37_07480) rimP 1591281..1591748 (-) 468 WP_002439519.1 ribosome maturation factor RimP -
  MUW37_RS07485 (MUW37_07485) - 1591927..1596237 (-) 4311 WP_002456566.1 PolC-type DNA polymerase III -
  MUW37_RS07490 (MUW37_07490) - 1596487..1598190 (-) 1704 WP_001829513.1 proline--tRNA ligase -
  MUW37_RS07495 (MUW37_07495) rseP 1598209..1599495 (-) 1287 WP_001829501.1 RIP metalloprotease RseP -
  MUW37_RS07500 (MUW37_07500) - 1599729..1600511 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  MUW37_RS07505 (MUW37_07505) - 1600515..1601285 (-) 771 WP_001832561.1 isoprenyl transferase -
  MUW37_RS07510 (MUW37_07510) frr 1601506..1602060 (-) 555 WP_001829472.1 ribosome recycling factor -
  MUW37_RS07515 (MUW37_07515) pyrH 1602077..1602799 (-) 723 WP_002439511.1 UMP kinase -
  MUW37_RS07520 (MUW37_07520) tsf 1602940..1603818 (-) 879 WP_002439509.1 translation elongation factor Ts -
  MUW37_RS07525 (MUW37_07525) rpsB 1603970..1604758 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  MUW37_RS07530 (MUW37_07530) codY 1605117..1605890 (-) 774 WP_002446289.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  MUW37_RS07535 (MUW37_07535) hslU 1605914..1607317 (-) 1404 WP_002469380.1 ATP-dependent protease ATPase subunit HslU -
  MUW37_RS07540 (MUW37_07540) hslV 1607386..1607928 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  MUW37_RS07545 (MUW37_07545) xerC 1607932..1608822 (-) 891 WP_002456225.1 tyrosine recombinase XerC -
  MUW37_RS07550 (MUW37_07550) trmFO 1609047..1610354 (-) 1308 WP_001832560.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  MUW37_RS07555 (MUW37_07555) topA 1610379..1612448 (-) 2070 WP_001829508.1 type I DNA topoisomerase -
  MUW37_RS07560 (MUW37_07560) dprA 1612631..1613503 (-) 873 WP_001829468.1 DNA-processing protein DprA Machinery gene
  MUW37_RS07565 (MUW37_07565) - 1613844..1614059 (-) 216 Protein_1460 IS200/IS605 family transposase -
  MUW37_RS07570 (MUW37_07570) sucD 1614309..1615217 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  MUW37_RS07575 (MUW37_07575) sucC 1615239..1616405 (-) 1167 WP_002456569.1 ADP-forming succinate--CoA ligase subunit beta -
  MUW37_RS07580 (MUW37_07580) - 1616513..1617283 (-) 771 WP_001829514.1 ribonuclease HII -
  MUW37_RS07585 (MUW37_07585) ylqF 1617288..1618151 (-) 864 WP_001829495.1 ribosome biogenesis GTPase YlqF -
  MUW37_RS07590 (MUW37_07590) - 1618480..1621080 (+) 2601 WP_002456571.1 YfhO family protein -
  MUW37_RS07595 (MUW37_07595) - 1621073..1623676 (+) 2604 WP_002456572.1 YfhO family protein -
  MUW37_RS07600 (MUW37_07600) rplS 1624206..1624556 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  MUW37_RS07605 (MUW37_07605) trmD 1624662..1625399 (-) 738 WP_001829466.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  MUW37_RS07610 (MUW37_07610) rimM 1625399..1625902 (-) 504 WP_001832559.1 ribosome maturation factor RimM -
  MUW37_RS07615 (MUW37_07615) rpsP 1626029..1626304 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  MUW37_RS07620 (MUW37_07620) ffh 1626612..1627979 (-) 1368 WP_001830113.1 signal recognition particle protein -
  MUW37_RS07625 (MUW37_07625) - 1628010..1628342 (-) 333 WP_002457379.1 putative DNA-binding protein -
  MUW37_RS07630 (MUW37_07630) ftsY 1628344..1629570 (-) 1227 WP_002456573.1 signal recognition particle-docking protein FtsY -
  MUW37_RS07635 (MUW37_07635) smc 1629567..1633136 (-) 3570 WP_002456574.1 chromosome segregation protein SMC -
  MUW37_RS07640 (MUW37_07640) rnc 1633263..1634000 (-) 738 WP_002456575.1 ribonuclease III -
  MUW37_RS07645 (MUW37_07645) - 1634115..1634348 (-) 234 WP_001830184.1 acyl carrier protein -
  MUW37_RS07650 (MUW37_07650) fabG 1634576..1635310 (-) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  MUW37_RS07655 (MUW37_07655) fabD 1635303..1636229 (-) 927 WP_002469385.1 ACP S-malonyltransferase -
  MUW37_RS07660 (MUW37_07660) plsX 1636231..1637208 (-) 978 WP_002469384.1 phosphate acyltransferase PlsX -
  MUW37_RS07665 (MUW37_07665) fapR 1637210..1637770 (-) 561 WP_001830099.1 transcription factor FapR -
  MUW37_RS07670 (MUW37_07670) recG 1637929..1639977 (-) 2049 WP_002456579.1 ATP-dependent DNA helicase RecG -
  MUW37_RS07675 (MUW37_07675) fakA 1640181..1641839 (-) 1659 WP_002456580.1 fatty acid kinase catalytic subunit FakA -
  MUW37_RS07680 (MUW37_07680) - 1641854..1642228 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  MUW37_RS07685 (MUW37_07685) rpmB 1642586..1642774 (+) 189 WP_001830107.1 50S ribosomal protein L28 -
  MUW37_RS07690 (MUW37_07690) - 1642857..1643492 (-) 636 WP_001830164.1 thiamine diphosphokinase -
  MUW37_RS07695 (MUW37_07695) rpe 1643497..1644141 (-) 645 WP_002469381.1 ribulose-phosphate 3-epimerase -
  MUW37_RS07700 (MUW37_07700) rsgA 1644142..1645017 (-) 876 WP_002469378.1 ribosome small subunit-dependent GTPase A -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33726.62 Da        Isoelectric Point: 9.3618

>NTDB_id=675218 MUW37_RS07560 WP_001829468.1 1612631..1613503(-) (dprA) [Staphylococcus epidermidis strain SKN25lux]
MIQHTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=675218 MUW37_RS07560 WP_001829468.1 1612631..1613503(-) (dprA) [Staphylococcus epidermidis strain SKN25lux]
TTGATACAACATACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

56.944

99.31

0.566

  dprA Staphylococcus aureus MW2

56.944

99.31

0.566