Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MTX75_RS04005 | Genome accession | NZ_CP094857 |
| Coordinates | 833201..833644 (+) | Length | 147 a.a. |
| NCBI ID | WP_001099009.1 | Uniprot ID | A0A0C6EXF8 |
| Organism | Staphylococcus aureus strain ATCC 29213 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 823181..868207 | 833201..833644 | within | 0 |
Gene organization within MGE regions
Location: 823181..868207
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTX75_RS03915 (MTX75_03915) | sufB | 823181..824578 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| MTX75_RS03920 (MTX75_03920) | - | 824646..825695 (-) | 1050 | WP_031769022.1 | tyrosine-type recombinase/integrase | - |
| MTX75_RS03925 (MTX75_03925) | - | 825808..825987 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| MTX75_RS03930 (MTX75_03930) | - | 825967..826899 (-) | 933 | WP_000392186.1 | hypothetical protein | - |
| MTX75_RS03935 (MTX75_03935) | - | 826931..827656 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| MTX75_RS03940 (MTX75_03940) | - | 827684..828358 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MTX75_RS03945 (MTX75_03945) | - | 828375..828707 (-) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| MTX75_RS03950 (MTX75_03950) | - | 828970..829164 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| MTX75_RS03955 (MTX75_03955) | - | 829164..829931 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| MTX75_RS03960 (MTX75_03960) | - | 829932..830156 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| MTX75_RS03965 (MTX75_03965) | - | 830196..830645 (+) | 450 | WP_001094943.1 | hypothetical protein | - |
| MTX75_RS03970 (MTX75_03970) | - | 830659..830880 (+) | 222 | WP_064129667.1 | hypothetical protein | - |
| MTX75_RS03975 (MTX75_03975) | - | 830873..831016 (+) | 144 | WP_031769019.1 | DUF1270 family protein | - |
| MTX75_RS03980 (MTX75_03980) | - | 831127..831444 (+) | 318 | WP_031769017.1 | hypothetical protein | - |
| MTX75_RS03985 (MTX75_03985) | - | 831437..831739 (+) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| MTX75_RS03990 (MTX75_03990) | - | 831744..832004 (+) | 261 | WP_000291067.1 | DUF1108 family protein | - |
| MTX75_RS03995 (MTX75_03995) | - | 832017..832553 (+) | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| MTX75_RS04000 (MTX75_04000) | - | 832554..833204 (+) | 651 | WP_000840496.1 | ERF family protein | - |
| MTX75_RS04005 (MTX75_04005) | ssbA | 833201..833644 (+) | 444 | WP_001099009.1 | single-stranded DNA-binding protein | Machinery gene |
| MTX75_RS04010 (MTX75_04010) | - | 833656..834330 (+) | 675 | WP_031769015.1 | putative HNHc nuclease | - |
| MTX75_RS04015 (MTX75_04015) | - | 834436..835293 (-) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| MTX75_RS04020 (MTX75_04020) | - | 835358..836128 (+) | 771 | WP_031769013.1 | conserved phage C-terminal domain-containing protein | - |
| MTX75_RS04025 (MTX75_04025) | - | 836138..836911 (+) | 774 | WP_031769012.1 | ATP-binding protein | - |
| MTX75_RS04030 (MTX75_04030) | - | 836905..837066 (+) | 162 | WP_000237153.1 | hypothetical protein | - |
| MTX75_RS04035 (MTX75_04035) | - | 837079..837300 (+) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| MTX75_RS04040 (MTX75_04040) | - | 837311..837715 (+) | 405 | WP_031769010.1 | DUF1064 domain-containing protein | - |
| MTX75_RS04045 (MTX75_04045) | - | 837720..837905 (+) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| MTX75_RS04050 (MTX75_04050) | - | 837906..838523 (+) | 618 | WP_031769009.1 | SA1788 family PVL leukocidin-associated protein | - |
| MTX75_RS04055 (MTX75_04055) | - | 838523..838780 (+) | 258 | WP_031769008.1 | DUF3310 domain-containing protein | - |
| MTX75_RS04060 (MTX75_04060) | - | 838783..838983 (+) | 201 | WP_031769006.1 | hypothetical protein | - |
| MTX75_RS04065 (MTX75_04065) | - | 838992..839240 (+) | 249 | WP_078066199.1 | SAV1978 family virulence-associated passenger protein | - |
| MTX75_RS04070 (MTX75_04070) | - | 839254..839502 (+) | 249 | WP_031769005.1 | DUF1024 family protein | - |
| MTX75_RS04075 (MTX75_04075) | - | 839495..840022 (+) | 528 | WP_000185638.1 | dUTP pyrophosphatase | - |
| MTX75_RS04080 (MTX75_04080) | - | 840059..840295 (+) | 237 | WP_000195831.1 | DUF1381 domain-containing protein | - |
| MTX75_RS04085 (MTX75_04085) | - | 840320..840556 (+) | 237 | WP_031769004.1 | hypothetical protein | - |
| MTX75_RS04090 (MTX75_04090) | - | 840549..840722 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| MTX75_RS04095 (MTX75_04095) | - | 840723..841085 (+) | 363 | WP_000383791.1 | hypothetical protein | - |
| MTX75_RS04100 (MTX75_04100) | - | 841086..841232 (+) | 147 | WP_000989961.1 | hypothetical protein | - |
| MTX75_RS04105 (MTX75_04105) | - | 841247..841666 (+) | 420 | WP_000058634.1 | transcriptional regulator | - |
| MTX75_RS04110 (MTX75_04110) | - | 841853..842293 (+) | 441 | WP_001003272.1 | terminase small subunit | - |
| MTX75_RS04115 (MTX75_04115) | - | 842280..843557 (+) | 1278 | WP_031769002.1 | PBSX family phage terminase large subunit | - |
| MTX75_RS04120 (MTX75_04120) | - | 843568..845103 (+) | 1536 | WP_031769000.1 | phage portal protein | - |
| MTX75_RS04125 (MTX75_04125) | - | 845110..846105 (+) | 996 | WP_001556698.1 | minor capsid protein | - |
| MTX75_RS04130 (MTX75_04130) | - | 846178..846348 (+) | 171 | WP_000072207.1 | hypothetical protein | - |
| MTX75_RS04135 (MTX75_04135) | - | 846483..847097 (+) | 615 | WP_000354309.1 | DUF4355 domain-containing protein | - |
| MTX75_RS04140 (MTX75_04140) | - | 847111..848085 (+) | 975 | WP_031768999.1 | phage major capsid protein | - |
| MTX75_RS04145 (MTX75_04145) | - | 848107..848394 (+) | 288 | WP_001114085.1 | hypothetical protein | - |
| MTX75_RS04150 (MTX75_04150) | - | 848403..848735 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| MTX75_RS04155 (MTX75_04155) | - | 848732..849034 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| MTX75_RS04160 (MTX75_04160) | - | 849034..849381 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MTX75_RS04165 (MTX75_04165) | - | 849393..849776 (+) | 384 | WP_000188649.1 | hypothetical protein | - |
| MTX75_RS04170 (MTX75_04170) | - | 849795..850376 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| MTX75_RS04175 (MTX75_04175) | - | 850438..850803 (+) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| MTX75_RS04180 (MTX75_04180) | - | 850833..851177 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| MTX75_RS04185 (MTX75_04185) | - | 851194..854661 (+) | 3468 | WP_031768997.1 | membrane protein | - |
| MTX75_RS04190 (MTX75_04190) | - | 854674..855621 (+) | 948 | WP_000350683.1 | phage tail family protein | - |
| MTX75_RS04195 (MTX75_04195) | - | 855630..857531 (+) | 1902 | WP_031768995.1 | SGNH/GDSL hydrolase family protein | - |
| MTX75_RS04200 (MTX75_04200) | - | 857546..859456 (+) | 1911 | WP_031768993.1 | hypothetical protein | - |
| MTX75_RS04205 (MTX75_04205) | - | 859456..861279 (+) | 1824 | WP_031768991.1 | phage baseplate upper protein | - |
| MTX75_RS04210 (MTX75_04210) | - | 861279..861656 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| MTX75_RS04215 (MTX75_04215) | - | 861660..861833 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| MTX75_RS04220 (MTX75_04220) | - | 861873..862172 (+) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| MTX75_RS04225 (MTX75_04225) | - | 862309..864207 (+) | 1899 | WP_001836236.1 | glucosaminidase domain-containing protein | - |
| MTX75_RS04230 (MTX75_04230) | - | 864220..865458 (+) | 1239 | WP_016170467.1 | BppU family phage baseplate upper protein | - |
| MTX75_RS04235 (MTX75_04235) | - | 865464..865859 (+) | 396 | WP_016170466.1 | hypothetical protein | - |
| MTX75_RS04240 (MTX75_04240) | - | 865915..866190 (+) | 276 | WP_000351119.1 | phage holin | - |
| MTX75_RS04245 (MTX75_04245) | - | 866177..867589 (+) | 1413 | WP_031768990.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MTX75_RS04250 (MTX75_04250) | - | 867650..868207 (-) | 558 | WP_031768989.1 | DUF4888 domain-containing protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16321.89 Da Isoelectric Point: 5.8347
>NTDB_id=673710 MTX75_RS04005 WP_001099009.1 833201..833644(+) (ssbA) [Staphylococcus aureus strain ATCC 29213]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=673710 MTX75_RS04005 WP_001099009.1 833201..833644(+) (ssbA) [Staphylococcus aureus strain ATCC 29213]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.483 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
38.235 |
100 |
0.442 |