Detailed information
Bioinformatically predicted
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | MUA71_RS09960 | Genome accession | NZ_CP094806 |
| Coordinates | 2022178..2022741 (-) | Length | 187 a.a. |
| NCBI ID | WP_031266496.1 | Uniprot ID | - |
| Organism | Staphylococcus arlettae strain IVB6234 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1980122..2021696 | 2022178..2022741 | flank | 482 |
Gene organization within MGE regions
Location: 1980122..2022741
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA71_RS09625 (MUA71_09590) | - | 1980122..1980613 (-) | 492 | WP_262614949.1 | PBECR4 domain-containing protein | - |
| MUA71_RS09630 (MUA71_09595) | - | 1981361..1982737 (-) | 1377 | WP_262614950.1 | SH3 domain-containing protein | - |
| MUA71_RS09635 (MUA71_09600) | - | 1982753..1983010 (-) | 258 | WP_262614951.1 | phage holin | - |
| MUA71_RS09640 (MUA71_09605) | - | 1983159..1983458 (-) | 300 | WP_262614952.1 | DUF2951 domain-containing protein | - |
| MUA71_RS09645 (MUA71_09610) | - | 1983497..1983658 (-) | 162 | WP_262614953.1 | XkdX family protein | - |
| MUA71_RS09650 (MUA71_09615) | - | 1983639..1984049 (-) | 411 | WP_262614954.1 | DUF2977 domain-containing protein | - |
| MUA71_RS09655 (MUA71_09620) | - | 1984024..1985526 (-) | 1503 | WP_262614955.1 | phage baseplate upper protein | - |
| MUA71_RS09660 (MUA71_09625) | - | 1985539..1987464 (-) | 1926 | WP_262614956.1 | hypothetical protein | - |
| MUA71_RS09665 (MUA71_09630) | - | 1987483..1988016 (-) | 534 | WP_262614957.1 | hypothetical protein | - |
| MUA71_RS09670 (MUA71_09635) | - | 1988009..1989601 (-) | 1593 | WP_262614958.1 | prophage endopeptidase tail family protein | - |
| MUA71_RS09675 (MUA71_09640) | - | 1989611..1990435 (-) | 825 | WP_262614959.1 | phage tail family protein | - |
| MUA71_RS13695 | - | 1990448..1995178 (-) | 4731 | WP_316964948.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| MUA71_RS09690 (MUA71_09655) | gpG | 1995320..1995841 (-) | 522 | WP_262614960.1 | phage tail assembly chaperone G | - |
| MUA71_RS09695 (MUA71_09660) | gpG | 1995857..1996216 (-) | 360 | WP_262614961.1 | phage tail assembly chaperone G | - |
| MUA71_RS09700 (MUA71_09665) | - | 1996285..1996482 (-) | 198 | WP_262614962.1 | hypothetical protein | - |
| MUA71_RS09705 (MUA71_09670) | - | 1996501..1997097 (-) | 597 | WP_262614963.1 | major tail protein | - |
| MUA71_RS09710 (MUA71_09675) | - | 1997097..1997504 (-) | 408 | WP_262614964.1 | hypothetical protein | - |
| MUA71_RS09715 (MUA71_09680) | - | 1997525..1997914 (-) | 390 | WP_262614965.1 | hypothetical protein | - |
| MUA71_RS09720 (MUA71_09685) | - | 1997904..1998272 (-) | 369 | WP_262614966.1 | hypothetical protein | - |
| MUA71_RS09725 (MUA71_09690) | - | 1998256..1998543 (-) | 288 | WP_262614967.1 | phage head-tail connector protein | - |
| MUA71_RS09730 (MUA71_09695) | - | 1998558..1999751 (-) | 1194 | WP_262614968.1 | phage major capsid protein | - |
| MUA71_RS09735 (MUA71_09700) | - | 1999763..2000470 (-) | 708 | WP_262614970.1 | head maturation protease, ClpP-related | - |
| MUA71_RS09740 (MUA71_09705) | - | 2000433..2001611 (-) | 1179 | WP_262614971.1 | phage portal protein | - |
| MUA71_RS09745 (MUA71_09710) | - | 2001627..2003297 (-) | 1671 | WP_262614972.1 | terminase TerL endonuclease subunit | - |
| MUA71_RS09750 (MUA71_09715) | - | 2003294..2003656 (-) | 363 | WP_262614973.1 | hypothetical protein | - |
| MUA71_RS09755 (MUA71_09720) | - | 2003842..2004177 (-) | 336 | WP_262615965.1 | HNH endonuclease | - |
| MUA71_RS09760 (MUA71_09725) | - | 2004840..2005235 (-) | 396 | WP_262614974.1 | hypothetical protein | - |
| MUA71_RS09765 (MUA71_09730) | - | 2005249..2005524 (-) | 276 | WP_262614975.1 | hypothetical protein | - |
| MUA71_RS09770 | rinB | 2005837..2005971 (-) | 135 | WP_262614976.1 | transcriptional activator RinB | - |
| MUA71_RS09775 (MUA71_09735) | - | 2005968..2006342 (-) | 375 | WP_262614977.1 | hypothetical protein | - |
| MUA71_RS09780 (MUA71_09740) | - | 2006342..2006575 (-) | 234 | WP_069854434.1 | hypothetical protein | - |
| MUA71_RS09785 (MUA71_09745) | - | 2006577..2006795 (-) | 219 | WP_262614979.1 | DUF1381 domain-containing protein | - |
| MUA71_RS09790 (MUA71_09750) | - | 2006800..2006976 (-) | 177 | WP_262614980.1 | hypothetical protein | - |
| MUA71_RS09795 (MUA71_09755) | - | 2006990..2007220 (-) | 231 | WP_262614981.1 | hypothetical protein | - |
| MUA71_RS09800 (MUA71_09760) | - | 2007257..2007769 (-) | 513 | WP_262614982.1 | dUTP diphosphatase | - |
| MUA71_RS09805 (MUA71_09765) | - | 2007773..2008024 (-) | 252 | WP_262614983.1 | hypothetical protein | - |
| MUA71_RS09810 | - | 2008025..2008159 (-) | 135 | WP_262614984.1 | hypothetical protein | - |
| MUA71_RS09815 (MUA71_09770) | - | 2008160..2008456 (-) | 297 | WP_262614985.1 | hypothetical protein | - |
| MUA71_RS09820 (MUA71_09775) | - | 2008552..2008938 (-) | 387 | WP_262614987.1 | hypothetical protein | - |
| MUA71_RS09825 (MUA71_09780) | - | 2008935..2009249 (-) | 315 | WP_262614988.1 | DUF1140 family protein | - |
| MUA71_RS09830 (MUA71_09785) | - | 2009239..2009442 (-) | 204 | WP_262614990.1 | hypothetical protein | - |
| MUA71_RS09835 (MUA71_09790) | - | 2009443..2010051 (-) | 609 | WP_262614991.1 | DUF3310 domain-containing protein | - |
| MUA71_RS09840 (MUA71_09795) | - | 2010052..2010420 (-) | 369 | WP_262614992.1 | hypothetical protein | - |
| MUA71_RS09845 (MUA71_09800) | - | 2010433..2010636 (-) | 204 | WP_262614993.1 | hypothetical protein | - |
| MUA71_RS09850 (MUA71_09805) | - | 2010643..2011044 (-) | 402 | WP_262614994.1 | DUF1064 domain-containing protein | - |
| MUA71_RS09855 (MUA71_09810) | - | 2011045..2011206 (-) | 162 | WP_262614995.1 | hypothetical protein | - |
| MUA71_RS09860 (MUA71_09815) | - | 2011200..2011973 (-) | 774 | WP_262614996.1 | ATP-binding protein | - |
| MUA71_RS09865 (MUA71_09820) | - | 2011984..2012724 (-) | 741 | WP_262614998.1 | helix-turn-helix domain-containing protein | - |
| MUA71_RS09870 (MUA71_09825) | - | 2012711..2012923 (-) | 213 | WP_262614999.1 | helix-turn-helix domain-containing protein | - |
| MUA71_RS09875 (MUA71_09830) | - | 2012959..2013627 (-) | 669 | WP_262615000.1 | putative HNHc nuclease | - |
| MUA71_RS09880 (MUA71_09835) | - | 2013639..2014196 (-) | 558 | WP_262615001.1 | single-stranded DNA-binding protein | - |
| MUA71_RS09885 (MUA71_09840) | - | 2014220..2014987 (-) | 768 | WP_262615002.1 | ATP-binding protein | - |
| MUA71_RS09890 (MUA71_09845) | - | 2014988..2015473 (-) | 486 | WP_262615003.1 | siphovirus Gp157 family protein | - |
| MUA71_RS09895 (MUA71_09850) | - | 2015534..2015710 (-) | 177 | WP_262615004.1 | hypothetical protein | - |
| MUA71_RS09900 (MUA71_09855) | - | 2015722..2016045 (-) | 324 | WP_145232837.1 | DUF771 domain-containing protein | - |
| MUA71_RS09905 (MUA71_09860) | - | 2016077..2016424 (-) | 348 | WP_262615005.1 | hypothetical protein | - |
| MUA71_RS09910 (MUA71_09865) | - | 2016478..2017245 (-) | 768 | WP_262615006.1 | ParB/Srx family N-terminal domain-containing protein | - |
| MUA71_RS09915 (MUA71_09870) | - | 2017238..2018128 (-) | 891 | WP_262615007.1 | ParB N-terminal domain-containing protein | - |
| MUA71_RS09920 (MUA71_09875) | - | 2018166..2018378 (-) | 213 | WP_262615008.1 | helix-turn-helix transcriptional regulator | - |
| MUA71_RS09925 (MUA71_09880) | - | 2018532..2018846 (+) | 315 | WP_262615009.1 | helix-turn-helix transcriptional regulator | - |
| MUA71_RS09930 (MUA71_09885) | - | 2018858..2019322 (+) | 465 | WP_262615010.1 | toxin | - |
| MUA71_RS09935 (MUA71_09890) | - | 2019336..2020319 (+) | 984 | WP_262615011.1 | glycosyltransferase family 2 protein | - |
| MUA71_RS09940 (MUA71_09895) | - | 2020330..2020575 (+) | 246 | WP_262615012.1 | hypothetical protein | - |
| MUA71_RS09945 (MUA71_09900) | - | 2020635..2021696 (+) | 1062 | WP_262615013.1 | site-specific integrase | - |
| MUA71_RS09960 (MUA71_09915) | comK/comK1 | 2022178..2022741 (-) | 564 | WP_031266496.1 | competence protein ComK | Regulator |
Sequence
Protein
Download Length: 187 a.a. Molecular weight: 22445.95 Da Isoelectric Point: 9.8214
>NTDB_id=672957 MUA71_RS09960 WP_031266496.1 2022178..2022741(-) (comK/comK1) [Staphylococcus arlettae strain IVB6234]
MFSKYVIKKGDMVIQPIDTKERKYGGTRILKYKQQIEEVKDRTHKIIERSCRFYGSSYHFKKEDTIRITGIISKPPILFT
PLFPTYFFPTHSDRKDENAWINIHYVQHIKRLKDRKCKITFVDEQTLNIDISAHSMRHQYLNAIYYYYMMDRAARIATFD
PDAPIDYTKPQLNIYEALAKYSLFEHK
MFSKYVIKKGDMVIQPIDTKERKYGGTRILKYKQQIEEVKDRTHKIIERSCRFYGSSYHFKKEDTIRITGIISKPPILFT
PLFPTYFFPTHSDRKDENAWINIHYVQHIKRLKDRKCKITFVDEQTLNIDISAHSMRHQYLNAIYYYYMMDRAARIATFD
PDAPIDYTKPQLNIYEALAKYSLFEHK
Nucleotide
Download Length: 564 bp
>NTDB_id=672957 MUA71_RS09960 WP_031266496.1 2022178..2022741(-) (comK/comK1) [Staphylococcus arlettae strain IVB6234]
ATATTTAGTAAATATGTCATTAAGAAAGGAGACATGGTGATACAACCCATTGACACTAAAGAAAGAAAATATGGAGGGAC
GCGAATATTAAAATATAAACAACAGATAGAAGAAGTAAAAGATAGAACACACAAAATTATTGAGAGATCATGTCGTTTTT
ATGGCAGTAGCTATCACTTTAAAAAAGAAGATACCATTAGAATTACTGGAATTATCAGTAAACCGCCGATATTATTTACA
CCGCTATTTCCTACTTACTTTTTTCCTACCCATTCTGACAGAAAAGATGAAAATGCTTGGATTAATATTCATTATGTACA
ACATATAAAGAGATTAAAAGACAGAAAATGCAAAATTACTTTTGTTGATGAGCAAACACTTAATATAGATATTTCTGCAC
ATAGTATGAGGCATCAATATTTAAACGCCATTTATTACTATTATATGATGGATAGAGCAGCAAGGATTGCTACTTTTGAT
CCAGATGCACCAATCGATTATACTAAACCGCAATTAAATATTTATGAAGCATTAGCTAAGTACTCATTATTTGAACATAA
ATAA
ATATTTAGTAAATATGTCATTAAGAAAGGAGACATGGTGATACAACCCATTGACACTAAAGAAAGAAAATATGGAGGGAC
GCGAATATTAAAATATAAACAACAGATAGAAGAAGTAAAAGATAGAACACACAAAATTATTGAGAGATCATGTCGTTTTT
ATGGCAGTAGCTATCACTTTAAAAAAGAAGATACCATTAGAATTACTGGAATTATCAGTAAACCGCCGATATTATTTACA
CCGCTATTTCCTACTTACTTTTTTCCTACCCATTCTGACAGAAAAGATGAAAATGCTTGGATTAATATTCATTATGTACA
ACATATAAAGAGATTAAAAGACAGAAAATGCAAAATTACTTTTGTTGATGAGCAAACACTTAATATAGATATTTCTGCAC
ATAGTATGAGGCATCAATATTTAAACGCCATTTATTACTATTATATGATGGATAGAGCAGCAAGGATTGCTACTTTTGAT
CCAGATGCACCAATCGATTATACTAAACCGCAATTAAATATTTATGAAGCATTAGCTAAGTACTCATTATTTGAACATAA
ATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
53.968 |
100 |
0.545 |
| comK/comK1 | Staphylococcus aureus N315 |
53.968 |
100 |
0.545 |