Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MQC90_RS13350 Genome accession   NZ_CP094361
Coordinates   2547662..2547835 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain NCIB 3610     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2542662..2552835
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MQC90_RS13335 gcvT 2543461..2544549 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  MQC90_RS13340 yqhH 2544991..2546664 (+) 1674 WP_004398544.1 SNF2-related protein -
  MQC90_RS13345 yqhG 2546685..2547479 (+) 795 WP_003230200.1 YqhG family protein -
  MQC90_RS13350 sinI 2547662..2547835 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MQC90_RS13355 sinR 2547869..2548204 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MQC90_RS13360 tasA 2548297..2549082 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  MQC90_RS13365 sipW 2549146..2549718 (-) 573 WP_003246088.1 signal peptidase I -
  MQC90_RS13370 tapA 2549702..2550463 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  MQC90_RS13375 yqzG 2550735..2551061 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MQC90_RS13380 spoIIT 2551103..2551282 (-) 180 WP_003230176.1 YqzE family protein -
  MQC90_RS13385 comGG 2551353..2551727 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  MQC90_RS13390 comGF 2551728..2552111 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  MQC90_RS13395 comGE 2552137..2552484 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=669283 MQC90_RS13350 WP_003230187.1 2547662..2547835(+) (sinI) [Bacillus subtilis strain NCIB 3610]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=669283 MQC90_RS13350 WP_003230187.1 2547662..2547835(+) (sinI) [Bacillus subtilis strain NCIB 3610]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment