Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MQC90_RS13390 Genome accession   NZ_CP094361
Coordinates   2551728..2552111 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain NCIB 3610     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2546728..2557111
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MQC90_RS13350 sinI 2547662..2547835 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MQC90_RS13355 sinR 2547869..2548204 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MQC90_RS13360 tasA 2548297..2549082 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  MQC90_RS13365 sipW 2549146..2549718 (-) 573 WP_003246088.1 signal peptidase I -
  MQC90_RS13370 tapA 2549702..2550463 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  MQC90_RS13375 yqzG 2550735..2551061 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MQC90_RS13380 spoIIT 2551103..2551282 (-) 180 WP_003230176.1 YqzE family protein -
  MQC90_RS13385 comGG 2551353..2551727 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  MQC90_RS13390 comGF 2551728..2552111 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  MQC90_RS13395 comGE 2552137..2552484 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  MQC90_RS13400 comGD 2552468..2552899 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  MQC90_RS13405 comGC 2552889..2553185 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MQC90_RS13410 comGB 2553199..2554236 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  MQC90_RS13415 comGA 2554223..2555293 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MQC90_RS13420 corA 2555705..2556658 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=669286 MQC90_RS13390 WP_003230168.1 2551728..2552111(-) (comGF) [Bacillus subtilis strain NCIB 3610]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=669286 MQC90_RS13390 WP_003230168.1 2551728..2552111(-) (comGF) [Bacillus subtilis strain NCIB 3610]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment