Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG23_RS00690 Genome accession   NZ_CP094172
Coordinates   148930..149055 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe0002     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 143930..154055
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG23_RS00665 (MPG23_00665) - 143990..146212 (+) 2223 WP_245088624.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG23_RS00670 (MPG23_00670) panD 146202..146552 (+) 351 WP_180415978.1 aspartate 1-decarboxylase -
  MPG23_RS00675 (MPG23_00675) - 146563..146856 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG23_RS00680 (MPG23_00680) - 146856..147851 (+) 996 WP_245089673.1 PDZ domain-containing protein -
  MPG23_RS00685 (MPG23_00685) comB6 147859..148914 (+) 1056 WP_245089676.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG23_RS00690 (MPG23_00690) comB7 148930..149055 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG23_RS00695 (MPG23_00695) comB8 149052..149795 (+) 744 WP_245088626.1 virB8 family protein Machinery gene
  MPG23_RS00700 (MPG23_00700) comB9 149795..150757 (+) 963 WP_245088628.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG23_RS00705 (MPG23_00705) comB10 150750..151886 (+) 1137 WP_245088630.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG23_RS00710 (MPG23_00710) - 151956..153368 (+) 1413 WP_245088632.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667961 MPG23_RS00690 WP_001217874.1 148930..149055(+) (comB7) [Helicobacter pylori strain Hpfe0002]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667961 MPG23_RS00690 WP_001217874.1 148930..149055(+) (comB7) [Helicobacter pylori strain Hpfe0002]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment