Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPF84_RS00720 Genome accession   NZ_CP094149
Coordinates   151799..151924 (+) Length   41 a.a.
NCBI ID   WP_050833158.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe023     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 146799..156924
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF84_RS00695 (MPF84_00695) - 146859..149081 (+) 2223 WP_245085841.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF84_RS00700 (MPF84_00700) panD 149071..149421 (+) 351 WP_000142210.1 aspartate 1-decarboxylase -
  MPF84_RS00705 (MPF84_00705) - 149432..149725 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPF84_RS00710 (MPF84_00710) - 149725..150720 (+) 996 WP_245086718.1 PDZ domain-containing protein -
  MPF84_RS00715 (MPF84_00715) comB6 150728..151783 (+) 1056 WP_245086721.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF84_RS00720 (MPF84_00720) comB7 151799..151924 (+) 126 WP_050833158.1 hypothetical protein Machinery gene
  MPF84_RS00725 (MPF84_00725) comB8 151921..152664 (+) 744 WP_245085843.1 virB8 family protein Machinery gene
  MPF84_RS00730 (MPF84_00730) comB9 152664..153635 (+) 972 WP_245085845.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF84_RS00735 (MPF84_00735) comB10 153628..154764 (+) 1137 WP_245085847.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF84_RS00740 (MPF84_00740) - 154834..156246 (+) 1413 WP_245085849.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4832.84 Da        Isoelectric Point: 9.3278

>NTDB_id=667632 MPF84_RS00720 WP_050833158.1 151799..151924(+) (comB7) [Helicobacter pylori strain Hpfe023]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667632 MPF84_RS00720 WP_050833158.1 151799..151924(+) (comB7) [Helicobacter pylori strain Hpfe023]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

90.244

100

0.902

Multiple sequence alignment