Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG02_RS00690 Genome accession   NZ_CP094142
Coordinates   146267..146392 (+) Length   41 a.a.
NCBI ID   WP_120902658.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe033     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 141267..151392
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG02_RS00665 (MPG02_00665) - 141327..143549 (+) 2223 WP_245075424.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG02_RS00670 (MPG02_00670) panD 143539..143889 (+) 351 WP_245075425.1 aspartate 1-decarboxylase -
  MPG02_RS00675 (MPG02_00675) - 143900..144193 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG02_RS00680 (MPG02_00680) - 144193..145188 (+) 996 WP_245075895.1 PDZ domain-containing protein -
  MPG02_RS00685 (MPG02_00685) comB6 145196..146251 (+) 1056 WP_245075896.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG02_RS00690 (MPG02_00690) comB7 146267..146392 (+) 126 WP_120902658.1 comB7 lipoprotein Machinery gene
  MPG02_RS00695 (MPG02_00695) comB8 146389..147132 (+) 744 WP_180446597.1 virB8 family protein Machinery gene
  MPG02_RS00700 (MPG02_00700) comB9 147132..148100 (+) 969 WP_245075426.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG02_RS00705 (MPG02_00705) comB10 148093..149229 (+) 1137 WP_245075427.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG02_RS00710 (MPG02_00710) - 149299..150711 (+) 1413 WP_245075428.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4812.85 Da        Isoelectric Point: 9.3278

>NTDB_id=667508 MPG02_RS00690 WP_120902658.1 146267..146392(+) (comB7) [Helicobacter pylori strain Hpfe033]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667508 MPG02_RS00690 WP_120902658.1 146267..146392(+) (comB7) [Helicobacter pylori strain Hpfe033]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment