Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG78_RS00705 Genome accession   NZ_CP094119
Coordinates   153382..153507 (+) Length   41 a.a.
NCBI ID   WP_180434254.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe064     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 148382..158507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG78_RS00680 (MPG78_00680) - 148447..150666 (+) 2220 WP_245040276.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG78_RS00685 (MPG78_00685) panD 150656..151006 (+) 351 WP_245040278.1 aspartate 1-decarboxylase -
  MPG78_RS00690 (MPG78_00690) - 151017..151310 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG78_RS00695 (MPG78_00695) - 151310..152305 (+) 996 WP_245041096.1 PDZ domain-containing protein -
  MPG78_RS00700 (MPG78_00700) comB6 152311..153366 (+) 1056 WP_245027257.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG78_RS00705 (MPG78_00705) comB7 153382..153507 (+) 126 WP_180434254.1 comB7 lipoprotein Machinery gene
  MPG78_RS00710 (MPG78_00710) comB8 153504..154247 (+) 744 WP_000660529.1 virB8 family protein Machinery gene
  MPG78_RS00715 (MPG78_00715) comB9 154247..155209 (+) 963 WP_245040280.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG78_RS00720 (MPG78_00720) comB10 155202..156338 (+) 1137 WP_245040282.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG78_RS00725 (MPG78_00725) - 156408..157820 (+) 1413 WP_245040284.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4766.78 Da        Isoelectric Point: 9.3278

>NTDB_id=667107 MPG78_RS00705 WP_180434254.1 153382..153507(+) (comB7) [Helicobacter pylori strain Hpfe064]
MRIFSIIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667107 MPG78_RS00705 WP_180434254.1 153382..153507(+) (comB7) [Helicobacter pylori strain Hpfe064]
ATGAGAATTTTTTCTATCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

80.488

100

0.805

Multiple sequence alignment