Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPF90_RS00710 Genome accession   NZ_CP094090
Coordinates   149060..149185 (+) Length   41 a.a.
NCBI ID   WP_231172561.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe089     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 144060..154185
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF90_RS00685 (MPF90_00685) - 144120..146342 (+) 2223 WP_245023090.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF90_RS00690 (MPF90_00690) panD 146332..146682 (+) 351 WP_096524943.1 aspartate 1-decarboxylase -
  MPF90_RS00695 (MPF90_00695) - 146693..146986 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPF90_RS00700 (MPF90_00700) - 146986..147981 (+) 996 WP_245023413.1 PDZ domain-containing protein -
  MPF90_RS00705 (MPF90_00705) comB6 147989..149044 (+) 1056 WP_245023414.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF90_RS00710 (MPF90_00710) comB7 149060..149185 (+) 126 WP_231172561.1 comB7 lipoprotein Machinery gene
  MPF90_RS00715 (MPF90_00715) comB8 149182..149925 (+) 744 WP_245023091.1 virB8 family protein Machinery gene
  MPF90_RS00720 (MPF90_00720) comB9 149925..150890 (+) 966 WP_245023092.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF90_RS00725 (MPF90_00725) comB10 150883..152019 (+) 1137 WP_245023093.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF90_RS00730 (MPF90_00730) - 152089..153501 (+) 1413 WP_245023094.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4734.72 Da        Isoelectric Point: 9.3278

>NTDB_id=666667 MPF90_RS00710 WP_231172561.1 149060..149185(+) (comB7) [Helicobacter pylori strain Hpfe089]
MRIFSVIMGLILFGCTSKVHEIKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666667 MPF90_RS00710 WP_231172561.1 149060..149185(+) (comB7) [Helicobacter pylori strain Hpfe089]
ATGAGAATTTTTTCTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATAAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

80.488

100

0.805

Multiple sequence alignment