Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG40_RS00915 Genome accession   NZ_CP094088
Coordinates   194535..194660 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe092     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 189535..199660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG40_RS00890 (MPG40_00890) - 189597..191819 (+) 2223 WP_245063913.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG40_RS00895 (MPG40_00895) panD 191809..192159 (+) 351 WP_050833161.1 aspartate 1-decarboxylase -
  MPG40_RS00900 (MPG40_00900) - 192170..192463 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG40_RS00905 (MPG40_00905) - 192463..193458 (+) 996 WP_245064424.1 PDZ domain-containing protein -
  MPG40_RS00910 (MPG40_00910) comB6 193464..194519 (+) 1056 WP_245063915.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG40_RS00915 (MPG40_00915) comB7 194535..194660 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG40_RS00920 (MPG40_00920) comB8 194657..195400 (+) 744 WP_245063917.1 virB8 family protein Machinery gene
  MPG40_RS00925 (MPG40_00925) comB9 195400..196365 (+) 966 WP_245063919.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG40_RS00930 (MPG40_00930) comB10 196358..197494 (+) 1137 WP_245063921.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG40_RS00935 (MPG40_00935) - 197564..198976 (+) 1413 WP_245063923.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=666646 MPG40_RS00915 WP_001217867.1 194535..194660(+) (comB7) [Helicobacter pylori strain Hpfe092]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666646 MPG40_RS00915 WP_001217867.1 194535..194660(+) (comB7) [Helicobacter pylori strain Hpfe092]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTGTTTGGTTGCACAAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829