Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG31_RS00705 Genome accession   NZ_CP094074
Coordinates   148984..149109 (+) Length   41 a.a.
NCBI ID   WP_180661107.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe103     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 143984..154109
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG31_RS00680 (MPG31_00680) - 144044..146266 (+) 2223 WP_245015361.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG31_RS00685 (MPG31_00685) panD 146256..146606 (+) 351 WP_000142208.1 aspartate 1-decarboxylase -
  MPG31_RS00690 (MPG31_00690) - 146617..146910 (+) 294 WP_245015362.1 YbaB/EbfC family nucleoid-associated protein -
  MPG31_RS00695 (MPG31_00695) - 146910..147905 (+) 996 WP_245015690.1 PDZ domain-containing protein -
  MPG31_RS00700 (MPG31_00700) comB6 147913..148968 (+) 1056 WP_245015691.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG31_RS00705 (MPG31_00705) comB7 148984..149109 (+) 126 WP_180661107.1 comB7 lipoprotein Machinery gene
  MPG31_RS00710 (MPG31_00710) comB8 149106..149843 (+) 738 WP_075708163.1 virB8 family protein Machinery gene
  MPG31_RS00715 (MPG31_00715) comB9 149843..150808 (+) 966 WP_245015363.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG31_RS00720 (MPG31_00720) comB10 150801..151937 (+) 1137 WP_245015364.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG31_RS00725 (MPG31_00725) - 152007..153419 (+) 1413 WP_245015365.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4799.76 Da        Isoelectric Point: 7.8645

>NTDB_id=666452 MPG31_RS00705 WP_180661107.1 148984..149109(+) (comB7) [Helicobacter pylori strain Hpfe103]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEELYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666452 MPG31_RS00705 WP_180661107.1 148984..149109(+) (comB7) [Helicobacter pylori strain Hpfe103]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAGAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878