Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MOW04_RS16255 Genome accession   NZ_CP093546
Coordinates   3130717..3130857 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. K1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3125717..3135857
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MOW04_RS16230 - 3126071..3126451 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MOW04_RS16235 comA 3126470..3127114 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MOW04_RS16240 comP 3127195..3129483 (-) 2289 WP_163131567.1 histidine kinase Regulator
  MOW04_RS16245 comX 3129495..3129659 (-) 165 WP_015384519.1 competence pheromone ComX -
  MOW04_RS16250 - 3129672..3130532 (-) 861 WP_163131565.1 polyprenyl synthetase family protein -
  MOW04_RS16255 degQ 3130717..3130857 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MOW04_RS16260 - 3131079..3131204 (+) 126 WP_003228793.1 hypothetical protein -
  MOW04_RS16265 - 3131318..3131686 (+) 369 WP_014477834.1 hypothetical protein -
  MOW04_RS16270 pdeH 3131662..3132891 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MOW04_RS16275 - 3133028..3134500 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MOW04_RS16280 - 3134516..3135067 (-) 552 WP_128738184.1 isochorismatase family cysteine hydrolase -
  MOW04_RS16285 - 3135164..3135562 (-) 399 WP_128738185.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=665170 MOW04_RS16255 WP_003220708.1 3130717..3130857(-) (degQ) [Bacillus sp. K1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=665170 MOW04_RS16255 WP_003220708.1 3130717..3130857(-) (degQ) [Bacillus sp. K1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1