Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MNY35_RS16075 Genome accession   NZ_CP093298
Coordinates   3351964..3352104 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain MN-13     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3346964..3357104
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNY35_RS16050 (MNY35_16035) - 3347267..3347665 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  MNY35_RS16055 (MNY35_16040) - 3347762..3348313 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  MNY35_RS16060 (MNY35_16045) - 3348331..3349797 (+) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  MNY35_RS16065 (MNY35_16050) - 3349927..3351150 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  MNY35_RS16070 (MNY35_16055) - 3351157..3351498 (-) 342 WP_015418107.1 hypothetical protein -
  MNY35_RS16075 (MNY35_16060) degQ 3351964..3352104 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MNY35_RS16080 (MNY35_16065) comQ 3352235..3353173 (+) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  MNY35_RS16085 (MNY35_16070) comX 3353173..3353349 (+) 177 WP_007408675.1 competence pheromone ComX -
  MNY35_RS16090 (MNY35_16075) comP 3353369..3355678 (+) 2310 WP_033574914.1 histidine kinase Regulator
  MNY35_RS16095 (MNY35_16080) comA 3355759..3356403 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  MNY35_RS16100 (MNY35_16085) - 3356425..3356808 (+) 384 WP_007408674.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=663199 MNY35_RS16075 WP_003152043.1 3351964..3352104(+) (degQ) [Bacillus amyloliquefaciens strain MN-13]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=663199 MNY35_RS16075 WP_003152043.1 3351964..3352104(+) (degQ) [Bacillus amyloliquefaciens strain MN-13]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891