Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MNG38_RS16745 Genome accession   NZ_CP093289
Coordinates   3195448..3195588 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain H2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3190448..3200588
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNG38_RS16720 (MNG38_16720) yuxO 3190725..3191105 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  MNG38_RS16725 (MNG38_16725) comA 3191124..3191768 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MNG38_RS16730 (MNG38_16730) comP 3191849..3193972 (-) 2124 WP_242139175.1 sensor histidine kinase Regulator
  MNG38_RS16735 (MNG38_16735) comX 3194177..3194398 (-) 222 WP_014480704.1 competence pheromone ComX -
  MNG38_RS16740 (MNG38_16740) - 3194400..3195263 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  MNG38_RS16745 (MNG38_16745) degQ 3195448..3195588 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MNG38_RS16750 (MNG38_16750) - 3195810..3195935 (+) 126 WP_003228793.1 hypothetical protein -
  MNG38_RS16755 (MNG38_16755) - 3196050..3196418 (+) 369 WP_046381300.1 hypothetical protein -
  MNG38_RS16760 (MNG38_16760) pdeH 3196394..3197623 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  MNG38_RS16765 (MNG38_16765) pncB 3197760..3199232 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MNG38_RS16770 (MNG38_16770) pncA 3199248..3199799 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  MNG38_RS16775 (MNG38_16775) yueI 3199896..3200294 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=663011 MNG38_RS16745 WP_003220708.1 3195448..3195588(-) (degQ) [Bacillus subtilis strain H2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=663011 MNG38_RS16745 WP_003220708.1 3195448..3195588(-) (degQ) [Bacillus subtilis strain H2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1