Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   MNU36_RS09630 Genome accession   NZ_CP093198
Coordinates   1971632..1972207 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain TSM-18     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1927945..1971231 1971632..1972207 flank 401


Gene organization within MGE regions


Location: 1927945..1972207
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNU36_RS09285 (MNU36_09285) - 1927945..1928343 (-) 399 WP_002504241.1 hypothetical protein -
  MNU36_RS09290 (MNU36_09290) - 1928333..1928860 (-) 528 WP_002504240.1 Panacea domain-containing protein -
  MNU36_RS09295 (MNU36_09295) - 1929057..1930781 (-) 1725 WP_254104619.1 N-acetylmuramoyl-L-alanine amidase -
  MNU36_RS09300 (MNU36_09300) - 1930794..1931081 (-) 288 WP_049372071.1 phage holin -
  MNU36_RS09305 (MNU36_09305) - 1931136..1931663 (-) 528 WP_254104621.1 hypothetical protein -
  MNU36_RS09310 (MNU36_09310) - 1931663..1932172 (-) 510 WP_001830291.1 hypothetical protein -
  MNU36_RS09315 (MNU36_09315) - 1932226..1934019 (-) 1794 Protein_1808 glucosaminidase domain-containing protein -
  MNU36_RS09320 (MNU36_09320) - 1934133..1934753 (-) 621 WP_002505162.1 AP2 domain-containing protein -
  MNU36_RS09325 (MNU36_09325) - 1935249..1935548 (-) 300 WP_001830303.1 DUF2951 family protein -
  MNU36_RS09330 (MNU36_09330) - 1935585..1935725 (-) 141 WP_001830255.1 XkdX family protein -
  MNU36_RS09335 (MNU36_09335) - 1935727..1936065 (-) 339 WP_001830258.1 hypothetical protein -
  MNU36_RS09340 (MNU36_09340) - 1936070..1937602 (-) 1533 WP_001830265.1 BppU family phage baseplate upper protein -
  MNU36_RS09345 (MNU36_09345) - 1937602..1940268 (-) 2667 WP_001830294.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  MNU36_RS09350 (MNU36_09350) - 1940283..1942139 (-) 1857 WP_001830292.1 SGNH/GDSL hydrolase family protein -
  MNU36_RS09355 (MNU36_09355) - 1942153..1943091 (-) 939 WP_001830287.1 phage tail domain-containing protein -
  MNU36_RS09360 (MNU36_09360) - 1943107..1946211 (-) 3105 WP_254104622.1 terminase -
  MNU36_RS09365 (MNU36_09365) - 1946214..1946516 (-) 303 WP_001830305.1 hypothetical protein -
  MNU36_RS09370 (MNU36_09370) - 1946579..1947073 (-) 495 WP_001830298.1 tail assembly chaperone -
  MNU36_RS09375 (MNU36_09375) - 1947133..1947672 (-) 540 WP_032604494.1 tail protein -
  MNU36_RS09380 (MNU36_09380) - 1947659..1948096 (-) 438 WP_001830289.1 DUF3168 domain-containing protein -
  MNU36_RS09385 (MNU36_09385) - 1948109..1948522 (-) 414 WP_001830232.1 HK97-gp10 family putative phage morphogenesis protein -
  MNU36_RS09390 (MNU36_09390) - 1948515..1948844 (-) 330 WP_001830290.1 phage head closure protein -
  MNU36_RS09395 (MNU36_09395) - 1948837..1949151 (-) 315 WP_001830262.1 phage head-tail connector protein -
  MNU36_RS09400 (MNU36_09400) - 1949151..1949441 (-) 291 WP_049323318.1 Rho termination factor N-terminal domain-containing protein -
  MNU36_RS09405 (MNU36_09405) - 1949458..1950288 (-) 831 WP_049323322.1 N4-gp56 family major capsid protein -
  MNU36_RS09410 (MNU36_09410) - 1950306..1950902 (-) 597 WP_002439208.1 phage scaffolding protein -
  MNU36_RS09415 (MNU36_09415) - 1951016..1951222 (-) 207 WP_002468959.1 hypothetical protein -
  MNU36_RS09420 (MNU36_09420) - 1951330..1952307 (-) 978 WP_049323325.1 phage head morphogenesis protein -
  MNU36_RS09425 (MNU36_09425) - 1952276..1953700 (-) 1425 WP_049323327.1 phage portal protein -
  MNU36_RS09430 (MNU36_09430) - 1953706..1954971 (-) 1266 WP_002469485.1 PBSX family phage terminase large subunit -
  MNU36_RS09435 (MNU36_09435) - 1954955..1955335 (-) 381 WP_002469473.1 phBC6A51 family helix-turn-helix protein -
  MNU36_RS09440 (MNU36_09440) - 1955847..1956263 (-) 417 WP_049323330.1 RinA family phage transcriptional regulator -
  MNU36_RS09445 (MNU36_09445) - 1956266..1956406 (-) 141 WP_002469471.1 hypothetical protein -
  MNU36_RS09450 (MNU36_09450) - 1956394..1956792 (-) 399 WP_002469495.1 hypothetical protein -
  MNU36_RS09455 (MNU36_09455) - 1956998..1957168 (-) 171 WP_002468977.1 transcriptional activator RinB -
  MNU36_RS09460 (MNU36_09460) - 1957217..1957768 (-) 552 WP_254104624.1 dUTP pyrophosphatase -
  MNU36_RS09465 (MNU36_09465) - 1957761..1957940 (-) 180 WP_070858012.1 DUF1024 family protein -
  MNU36_RS09470 (MNU36_09470) - 1957930..1958178 (-) 249 WP_001830273.1 hypothetical protein -
  MNU36_RS09475 (MNU36_09475) - 1958168..1958467 (-) 300 WP_254104626.1 hypothetical protein -
  MNU36_RS09480 (MNU36_09480) - 1958451..1958651 (-) 201 WP_032605777.1 hypothetical protein -
  MNU36_RS09485 (MNU36_09485) - 1958638..1959252 (-) 615 WP_049371707.1 HNH endonuclease signature motif containing protein -
  MNU36_RS09490 (MNU36_09490) - 1959258..1959488 (-) 231 WP_049371709.1 hypothetical protein -
  MNU36_RS09495 (MNU36_09495) - 1959493..1959936 (-) 444 WP_254104628.1 DUF3310 domain-containing protein -
  MNU36_RS09500 (MNU36_09500) - 1959933..1960292 (-) 360 WP_002488921.1 SA1788 family PVL leukocidin-associated protein -
  MNU36_RS09505 (MNU36_09505) - 1960293..1960484 (-) 192 WP_002456879.1 hypothetical protein -
  MNU36_RS09510 (MNU36_09510) - 1960484..1960858 (-) 375 WP_002488901.1 hypothetical protein -
  MNU36_RS09515 (MNU36_09515) - 1960845..1961261 (-) 417 WP_002488940.1 DUF1064 domain-containing protein -
  MNU36_RS09520 (MNU36_09520) - 1961271..1961516 (-) 246 WP_002456877.1 hypothetical protein -
  MNU36_RS09525 (MNU36_09525) - 1961516..1961677 (-) 162 WP_002456876.1 hypothetical protein -
  MNU36_RS09530 (MNU36_09530) - 1961671..1962432 (-) 762 WP_254104676.1 ATP-binding protein -
  MNU36_RS09535 (MNU36_09535) - 1962454..1963233 (-) 780 WP_049372094.1 conserved phage C-terminal domain-containing protein -
  MNU36_RS09540 (MNU36_09540) - 1963226..1963999 (-) 774 WP_049372095.1 hypothetical protein -
  MNU36_RS09545 (MNU36_09545) - 1964005..1964235 (-) 231 WP_254104630.1 helix-turn-helix domain-containing protein -
  MNU36_RS09550 (MNU36_09550) - 1964213..1964899 (-) 687 WP_254104631.1 putative HNHc nuclease -
  MNU36_RS09555 (MNU36_09555) - 1964913..1965335 (-) 423 WP_002456369.1 single-stranded DNA-binding protein -
  MNU36_RS09560 (MNU36_09560) - 1965328..1965954 (-) 627 WP_002469464.1 DUF1071 domain-containing protein -
  MNU36_RS09565 (MNU36_09565) - 1965947..1966171 (-) 225 WP_001830261.1 DUF2483 family protein -
  MNU36_RS09570 (MNU36_09570) - 1966143..1966418 (-) 276 WP_254104632.1 chordopoxvirus fusion protein -
  MNU36_RS09575 (MNU36_09575) - 1966473..1966649 (-) 177 WP_002504196.1 hypothetical protein -
  MNU36_RS09580 (MNU36_09580) - 1966744..1967022 (+) 279 WP_002484728.1 hypothetical protein -
  MNU36_RS09585 (MNU36_09585) - 1967009..1967155 (-) 147 WP_002484748.1 hypothetical protein -
  MNU36_RS09590 (MNU36_09590) - 1967169..1967378 (-) 210 WP_001830281.1 hypothetical protein -
  MNU36_RS09595 (MNU36_09595) - 1967391..1968107 (-) 717 WP_049371719.1 BRO family protein -
  MNU36_RS09600 (MNU36_09600) - 1968121..1968336 (-) 216 WP_001830251.1 transcriptional regulator -
  MNU36_RS09605 (MNU36_09605) - 1968533..1969144 (+) 612 WP_002468741.1 LexA family transcriptional regulator -
  MNU36_RS09610 (MNU36_09610) - 1969200..1970123 (+) 924 WP_049372101.1 DUF5067 domain-containing protein -
  MNU36_RS09615 (MNU36_09615) - 1970182..1971231 (+) 1050 WP_049372102.1 site-specific integrase -
  MNU36_RS09630 (MNU36_09630) comK/comK1 1971632..1972207 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=662405 MNU36_RS09630 WP_001829272.1 1971632..1972207(-) (comK/comK1) [Staphylococcus epidermidis strain TSM-18]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=662405 MNU36_RS09630 WP_001829272.1 1971632..1972207(-) (comK/comK1) [Staphylococcus epidermidis strain TSM-18]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(7-158)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743
  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743