Detailed information
Bioinformatically predicted
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | MNU55_RS09645 | Genome accession | NZ_CP093196 |
| Coordinates | 1999132..1999707 (-) | Length | 191 a.a. |
| NCBI ID | WP_254105930.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain TMDU-2014-62 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1956624..1998731 | 1999132..1999707 | flank | 401 |
Gene organization within MGE regions
Location: 1956624..1999707
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNU55_RS09370 (MNU55_09370) | - | 1958068..1958727 (-) | 660 | WP_194086754.1 | hypothetical protein | - |
| MNU55_RS09375 (MNU55_09375) | - | 1958735..1959100 (-) | 366 | WP_194086753.1 | hypothetical protein | - |
| MNU55_RS09380 (MNU55_09380) | - | 1959069..1959986 (-) | 918 | WP_194086752.1 | ParA family protein | - |
| MNU55_RS09385 (MNU55_09385) | - | 1960473..1961936 (-) | 1464 | WP_254104868.1 | SH3 domain-containing protein | - |
| MNU55_RS09390 (MNU55_09390) | - | 1961911..1962321 (-) | 411 | WP_254104865.1 | phage holin | - |
| MNU55_RS09395 (MNU55_09395) | - | 1962385..1962783 (-) | 399 | WP_254104863.1 | YxeA family protein | - |
| MNU55_RS09400 (MNU55_09400) | - | 1962941..1963348 (-) | 408 | WP_059223927.1 | hypothetical protein | - |
| MNU55_RS09405 (MNU55_09405) | - | 1963335..1963760 (-) | 426 | WP_002456415.1 | hypothetical protein | - |
| MNU55_RS09410 (MNU55_09410) | - | 1963757..1964380 (-) | 624 | WP_059223933.1 | poly-gamma-glutamate hydrolase family protein | - |
| MNU55_RS09415 (MNU55_09415) | - | 1964385..1965599 (-) | 1215 | WP_254104861.1 | BppU family phage baseplate upper protein | - |
| MNU55_RS09420 (MNU55_09420) | - | 1965599..1967461 (-) | 1863 | WP_254104859.1 | M14 family metallopeptidase | - |
| MNU55_RS09425 (MNU55_09425) | - | 1967477..1967650 (-) | 174 | WP_254104856.1 | hypothetical protein | - |
| MNU55_RS09430 (MNU55_09430) | - | 1967643..1969202 (-) | 1560 | WP_254105925.1 | prophage endopeptidase tail family protein | - |
| MNU55_RS09435 (MNU55_09435) | - | 1969212..1970045 (-) | 834 | WP_059223520.1 | phage tail domain-containing protein | - |
| MNU55_RS09440 (MNU55_09440) | - | 1970047..1974759 (-) | 4713 | WP_254104851.1 | phage tail tape measure protein | - |
| MNU55_RS09445 (MNU55_09445) | - | 1974788..1975303 (-) | 516 | WP_059223518.1 | hypothetical protein | - |
| MNU55_RS09450 (MNU55_09450) | - | 1975319..1975678 (-) | 360 | WP_059223517.1 | hypothetical protein | - |
| MNU55_RS09455 (MNU55_09455) | - | 1975742..1975927 (-) | 186 | WP_002503473.1 | hypothetical protein | - |
| MNU55_RS09460 (MNU55_09460) | - | 1975946..1976575 (-) | 630 | WP_059223516.1 | major tail protein | - |
| MNU55_RS09465 (MNU55_09465) | - | 1976588..1976992 (-) | 405 | WP_100481682.1 | hypothetical protein | - |
| MNU55_RS09470 (MNU55_09470) | - | 1976995..1977261 (-) | 267 | WP_080356004.1 | hypothetical protein | - |
| MNU55_RS09475 (MNU55_09475) | - | 1977396..1977725 (-) | 330 | WP_100481683.1 | head-tail adaptor protein | - |
| MNU55_RS09480 (MNU55_09480) | - | 1977715..1978056 (-) | 342 | WP_070840824.1 | head-tail connector protein | - |
| MNU55_RS09485 (MNU55_09485) | - | 1978075..1979433 (-) | 1359 | WP_059223512.1 | phage major capsid protein | - |
| MNU55_RS09490 (MNU55_09490) | - | 1979473..1980030 (-) | 558 | WP_059223511.1 | HK97 family phage prohead protease | - |
| MNU55_RS09495 (MNU55_09495) | - | 1980020..1981252 (-) | 1233 | WP_059223510.1 | phage portal protein | - |
| MNU55_RS09500 (MNU55_09500) | - | 1981255..1981449 (-) | 195 | WP_002500102.1 | hypothetical protein | - |
| MNU55_RS09505 (MNU55_09505) | - | 1981461..1983212 (-) | 1752 | WP_194086743.1 | terminase TerL endonuclease subunit | - |
| MNU55_RS09510 (MNU55_09510) | - | 1983205..1983675 (-) | 471 | WP_002484733.1 | phage terminase small subunit P27 family | - |
| MNU55_RS09515 (MNU55_09515) | - | 1983818..1984168 (-) | 351 | WP_083315469.1 | HNH endonuclease signature motif containing protein | - |
| MNU55_RS09520 (MNU55_09520) | - | 1984764..1985210 (-) | 447 | WP_059223508.1 | transcriptional regulator | - |
| MNU55_RS09525 (MNU55_09525) | - | 1985227..1985376 (-) | 150 | WP_002484731.1 | DUF1514 family protein | - |
| MNU55_RS09530 (MNU55_09530) | - | 1985376..1985543 (-) | 168 | WP_059223507.1 | regulator | - |
| MNU55_RS09535 (MNU55_09535) | - | 1985648..1985950 (+) | 303 | WP_059223506.1 | DUF4870 domain-containing protein | - |
| MNU55_RS09540 (MNU55_09540) | dut | 1986046..1986468 (-) | 423 | WP_252918107.1 | dUTP diphosphatase | - |
| MNU55_RS09545 (MNU55_09545) | - | 1986525..1986842 (+) | 318 | WP_228064100.1 | hypothetical protein | - |
| MNU55_RS09550 (MNU55_09550) | - | 1986852..1987058 (-) | 207 | WP_059223504.1 | hypothetical protein | - |
| MNU55_RS09555 (MNU55_09555) | - | 1987059..1987466 (-) | 408 | WP_059223503.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MNU55_RS09560 (MNU55_09560) | - | 1987506..1988393 (-) | 888 | WP_254105928.1 | DnaD domain-containing protein | - |
| MNU55_RS09565 (MNU55_09565) | ssbA | 1988423..1988896 (-) | 474 | WP_059223501.1 | single-stranded DNA-binding protein | Machinery gene |
| MNU55_RS09570 (MNU55_09570) | - | 1988897..1989514 (-) | 618 | WP_254104909.1 | MBL fold metallo-hydrolase | - |
| MNU55_RS09575 (MNU55_09575) | - | 1989595..1990518 (-) | 924 | WP_059223500.1 | recombinase RecT | - |
| MNU55_RS09580 (MNU55_09580) | - | 1990520..1992472 (-) | 1953 | WP_194086741.1 | AAA family ATPase | - |
| MNU55_RS09585 (MNU55_09585) | - | 1992805..1993071 (+) | 267 | WP_002456364.1 | hypothetical protein | - |
| MNU55_RS09590 (MNU55_09590) | - | 1993198..1993407 (-) | 210 | WP_001830281.1 | hypothetical protein | - |
| MNU55_RS09595 (MNU55_09595) | - | 1993420..1994136 (-) | 717 | WP_002468739.1 | phage repressor protein | - |
| MNU55_RS09600 (MNU55_09600) | - | 1994150..1994389 (-) | 240 | WP_194086740.1 | helix-turn-helix transcriptional regulator | - |
| MNU55_RS09605 (MNU55_09605) | - | 1994583..1994912 (+) | 330 | WP_002484747.1 | helix-turn-helix domain-containing protein | - |
| MNU55_RS09610 (MNU55_09610) | - | 1994925..1995386 (+) | 462 | WP_002484735.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MNU55_RS09615 (MNU55_09615) | - | 1995555..1995722 (+) | 168 | WP_002497581.1 | hypothetical protein | - |
| MNU55_RS09620 (MNU55_09620) | - | 1995726..1996883 (+) | 1158 | WP_164493043.1 | CapA family protein | - |
| MNU55_RS09625 (MNU55_09625) | - | 1997068..1997619 (+) | 552 | WP_103422871.1 | Ltp family lipoprotein | - |
| MNU55_RS09630 (MNU55_09630) | - | 1997682..1998731 (+) | 1050 | WP_001830299.1 | site-specific integrase | - |
| MNU55_RS09645 (MNU55_09645) | comK/comK1 | 1999132..1999707 (-) | 576 | WP_254105930.1 | competence protein ComK | Regulator |
Sequence
Protein
Download Length: 191 a.a. Molecular weight: 22767.85 Da Isoelectric Point: 9.0397
>NTDB_id=662371 MNU55_RS09645 WP_254105930.1 1999132..1999707(-) (comK/comK1) [Staphylococcus epidermidis strain TMDU-2014-62]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCIFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCIFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
Nucleotide
Download Length: 576 bp
>NTDB_id=662371 MNU55_RS09645 WP_254105930.1 1999132..1999707(-) (comK/comK1) [Staphylococcus epidermidis strain TMDU-2014-62]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTATATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTATATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
76.216 |
96.859 |
0.738 |
| comK/comK1 | Staphylococcus aureus N315 |
76.216 |
96.859 |
0.738 |