Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MNU45_RS08840 | Genome accession | NZ_CP093188 |
| Coordinates | 1888357..1888935 (-) | Length | 192 a.a. |
| NCBI ID | WP_254106687.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain TMDU-302 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1857807..1898841 | 1888357..1888935 | within | 0 |
Gene organization within MGE regions
Location: 1857807..1898841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNU45_RS08620 (MNU45_08615) | - | 1857807..1859270 (-) | 1464 | WP_058649790.1 | SH3 domain-containing protein | - |
| MNU45_RS08625 (MNU45_08620) | - | 1859245..1859655 (-) | 411 | WP_058649791.1 | phage holin | - |
| MNU45_RS08630 (MNU45_08625) | - | 1859719..1860117 (-) | 399 | WP_002498283.1 | YxeA family protein | - |
| MNU45_RS08635 (MNU45_08630) | - | 1860275..1860682 (-) | 408 | WP_058649792.1 | hypothetical protein | - |
| MNU45_RS08640 (MNU45_08635) | - | 1860669..1861094 (-) | 426 | WP_002456415.1 | hypothetical protein | - |
| MNU45_RS08645 (MNU45_08640) | - | 1861091..1861714 (-) | 624 | WP_058649901.1 | poly-gamma-glutamate hydrolase family protein | - |
| MNU45_RS08650 (MNU45_08645) | - | 1861719..1862933 (-) | 1215 | WP_058649793.1 | BppU family phage baseplate upper protein | - |
| MNU45_RS08655 (MNU45_08650) | - | 1862933..1864795 (-) | 1863 | WP_058649794.1 | M14 family metallopeptidase | - |
| MNU45_RS08660 (MNU45_08655) | - | 1864811..1864984 (-) | 174 | WP_002453517.1 | hypothetical protein | - |
| MNU45_RS08665 (MNU45_08660) | - | 1864977..1866536 (-) | 1560 | WP_186309565.1 | prophage endopeptidase tail family protein | - |
| MNU45_RS08670 (MNU45_08665) | - | 1866546..1867379 (-) | 834 | WP_058649796.1 | phage tail domain-containing protein | - |
| MNU45_RS08675 (MNU45_08670) | - | 1867381..1872030 (-) | 4650 | WP_058649797.1 | phage tail tape measure protein | - |
| MNU45_RS08680 (MNU45_08675) | - | 1872059..1872211 (-) | 153 | WP_186309566.1 | hypothetical protein | - |
| MNU45_RS08685 (MNU45_08680) | - | 1872244..1872606 (-) | 363 | WP_058649798.1 | hypothetical protein | - |
| MNU45_RS08690 (MNU45_08685) | - | 1872670..1872855 (-) | 186 | WP_002499233.1 | hypothetical protein | - |
| MNU45_RS08695 (MNU45_08690) | - | 1872874..1873500 (-) | 627 | WP_002499234.1 | major tail protein | - |
| MNU45_RS08700 (MNU45_08695) | - | 1873513..1873917 (-) | 405 | WP_002499235.1 | hypothetical protein | - |
| MNU45_RS08705 (MNU45_08700) | - | 1873920..1874186 (-) | 267 | WP_228279881.1 | hypothetical protein | - |
| MNU45_RS08710 (MNU45_08705) | - | 1874321..1874650 (-) | 330 | WP_058649800.1 | hypothetical protein | - |
| MNU45_RS08715 (MNU45_08710) | - | 1874640..1874981 (-) | 342 | WP_017464452.1 | head-tail connector protein | - |
| MNU45_RS08720 (MNU45_08715) | - | 1875000..1876337 (-) | 1338 | WP_058649801.1 | phage major capsid protein | - |
| MNU45_RS08725 (MNU45_08720) | - | 1876379..1876936 (-) | 558 | WP_058649802.1 | HK97 family phage prohead protease | - |
| MNU45_RS08730 (MNU45_08725) | - | 1876926..1878158 (-) | 1233 | WP_058649803.1 | phage portal protein | - |
| MNU45_RS08735 (MNU45_08730) | - | 1878158..1878352 (-) | 195 | WP_002497601.1 | hypothetical protein | - |
| MNU45_RS08740 (MNU45_08735) | - | 1878364..1880115 (-) | 1752 | WP_058649804.1 | terminase TerL endonuclease subunit | - |
| MNU45_RS08745 (MNU45_08740) | - | 1880108..1880593 (-) | 486 | WP_058649805.1 | phage terminase small subunit P27 family | - |
| MNU45_RS08750 (MNU45_08745) | - | 1880753..1881103 (-) | 351 | WP_058649806.1 | HNH endonuclease | - |
| MNU45_RS08755 (MNU45_08750) | - | 1881587..1882033 (-) | 447 | WP_002502054.1 | transcriptional regulator | - |
| MNU45_RS08760 (MNU45_08755) | - | 1882202..1882384 (-) | 183 | WP_002502052.1 | hypothetical protein | - |
| MNU45_RS08765 (MNU45_08760) | - | 1882489..1882791 (+) | 303 | WP_058649807.1 | DUF4870 domain-containing protein | - |
| MNU45_RS08770 (MNU45_08765) | dut | 1882886..1883308 (-) | 423 | WP_058649808.1 | dUTP diphosphatase | - |
| MNU45_RS08775 (MNU45_08770) | - | 1883365..1883682 (+) | 318 | WP_228279882.1 | hypothetical protein | - |
| MNU45_RS08780 (MNU45_08775) | - | 1883834..1884022 (-) | 189 | WP_058649809.1 | hypothetical protein | - |
| MNU45_RS08785 (MNU45_08780) | - | 1884012..1884239 (-) | 228 | WP_228279886.1 | DUF3310 domain-containing protein | - |
| MNU45_RS08790 (MNU45_08785) | - | 1884272..1884685 (-) | 414 | WP_058649810.1 | SA1788 family PVL leukocidin-associated protein | - |
| MNU45_RS08795 (MNU45_08790) | - | 1884686..1884877 (-) | 192 | WP_058649811.1 | hypothetical protein | - |
| MNU45_RS08800 (MNU45_08795) | - | 1884878..1885285 (-) | 408 | WP_058649812.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MNU45_RS08805 (MNU45_08800) | - | 1885295..1885540 (-) | 246 | WP_002497109.1 | hypothetical protein | - |
| MNU45_RS08810 (MNU45_08805) | - | 1885540..1885698 (-) | 159 | WP_193756313.1 | hypothetical protein | - |
| MNU45_RS08815 (MNU45_08810) | - | 1885692..1886453 (-) | 762 | WP_237616152.1 | ATP-binding protein | - |
| MNU45_RS08820 (MNU45_08815) | - | 1886473..1887243 (-) | 771 | WP_058649813.1 | conserved phage C-terminal domain-containing protein | - |
| MNU45_RS08825 (MNU45_08820) | - | 1887230..1887445 (-) | 216 | WP_058649814.1 | helix-turn-helix domain-containing protein | - |
| MNU45_RS08830 (MNU45_08825) | - | 1887451..1887681 (-) | 231 | WP_058649815.1 | helix-turn-helix domain-containing protein | - |
| MNU45_RS08835 (MNU45_08830) | - | 1887659..1888345 (-) | 687 | WP_058649816.1 | putative HNHc nuclease | - |
| MNU45_RS08840 (MNU45_08835) | ssbA | 1888357..1888935 (-) | 579 | WP_254106687.1 | single-stranded DNA-binding protein | Machinery gene |
| MNU45_RS08845 (MNU45_08840) | - | 1888938..1889570 (-) | 633 | WP_058649818.1 | ERF family protein | - |
| MNU45_RS08850 (MNU45_08845) | - | 1889571..1890056 (-) | 486 | WP_058649819.1 | siphovirus Gp157 family protein | - |
| MNU45_RS08855 (MNU45_08850) | - | 1890049..1890303 (-) | 255 | WP_058649820.1 | hypothetical protein | - |
| MNU45_RS08860 (MNU45_08855) | - | 1890387..1890560 (-) | 174 | WP_127873721.1 | DUF1270 family protein | - |
| MNU45_RS08865 (MNU45_08860) | - | 1890651..1890854 (+) | 204 | WP_058649821.1 | hypothetical protein | - |
| MNU45_RS08870 (MNU45_08865) | - | 1890829..1891017 (-) | 189 | WP_058649822.1 | hypothetical protein | - |
| MNU45_RS08875 (MNU45_08870) | - | 1891033..1891242 (-) | 210 | WP_049367120.1 | hypothetical protein | - |
| MNU45_RS08880 (MNU45_08875) | - | 1891303..1891515 (+) | 213 | WP_058649823.1 | hypothetical protein | - |
| MNU45_RS08885 (MNU45_08880) | - | 1891521..1891607 (-) | 87 | Protein_1726 | hypothetical protein | - |
| MNU45_RS08890 (MNU45_08885) | - | 1891620..1892375 (-) | 756 | WP_058649824.1 | phage regulatory protein/antirepressor Ant | - |
| MNU45_RS08895 (MNU45_08890) | - | 1892424..1892687 (+) | 264 | WP_058649825.1 | CRISPR-associated endonuclease Cas2 | - |
| MNU45_RS08900 (MNU45_08895) | - | 1892684..1892851 (-) | 168 | WP_186309568.1 | hypothetical protein | - |
| MNU45_RS08905 (MNU45_08900) | - | 1892886..1893332 (-) | 447 | WP_058649826.1 | hypothetical protein | - |
| MNU45_RS08910 (MNU45_08905) | - | 1893357..1893584 (-) | 228 | WP_058649827.1 | hypothetical protein | - |
| MNU45_RS08915 (MNU45_08910) | - | 1893756..1894367 (+) | 612 | WP_058649828.1 | LexA family transcriptional regulator | - |
| MNU45_RS08920 (MNU45_08915) | - | 1894412..1894579 (+) | 168 | WP_017464425.1 | hypothetical protein | - |
| MNU45_RS08925 (MNU45_08920) | - | 1894646..1895740 (+) | 1095 | WP_254106689.1 | CapA family protein | - |
| MNU45_RS08930 (MNU45_08925) | - | 1895949..1896548 (+) | 600 | WP_254106691.1 | hypothetical protein | - |
| MNU45_RS08935 (MNU45_08930) | - | 1896617..1897507 (+) | 891 | WP_058649831.1 | hypothetical protein | - |
| MNU45_RS08940 (MNU45_08935) | - | 1897518..1897697 (-) | 180 | WP_032606349.1 | hypothetical protein | - |
| MNU45_RS08945 (MNU45_08940) | - | 1897792..1898841 (+) | 1050 | WP_058649832.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 192 a.a. Molecular weight: 21808.41 Da Isoelectric Point: 4.8538
>NTDB_id=662298 MNU45_RS08840 WP_254106687.1 1888357..1888935(-) (ssbA) [Staphylococcus epidermidis strain TMDU-302]
MINRAVLVGRLTKDPEFRQTASGVSVTTFTLAVNRTFKNKNGEREADFINIVVFRQQAENVNNYLSKGSLAGVDGRIQSR
SYDNNEGQRVFVTEVVADNVQFLDSGNKNNNNQNGGYQQNNNYQQNNGYQPNNNYQPTQQNNSYQPPQQNQNNYQPPQQQ
NTSYQPPQQNQQQNPFANANGPIDIQDEDLPF
MINRAVLVGRLTKDPEFRQTASGVSVTTFTLAVNRTFKNKNGEREADFINIVVFRQQAENVNNYLSKGSLAGVDGRIQSR
SYDNNEGQRVFVTEVVADNVQFLDSGNKNNNNQNGGYQQNNNYQQNNGYQPNNNYQPTQQNNSYQPPQQNQNNYQPPQQQ
NTSYQPPQQNQQQNPFANANGPIDIQDEDLPF
Nucleotide
Download Length: 579 bp
>NTDB_id=662298 MNU45_RS08840 WP_254106687.1 1888357..1888935(-) (ssbA) [Staphylococcus epidermidis strain TMDU-302]
ATGATAAACAGAGCAGTTTTAGTAGGTAGATTAACAAAGGATCCGGAATTTAGACAAACAGCAAGTGGGGTAAGTGTAAC
CACATTTACATTAGCAGTAAATAGAACATTCAAAAATAAAAACGGCGAAAGAGAAGCAGATTTTATCAATATAGTTGTAT
TTAGACAACAAGCAGAAAACGTTAATAATTATCTTTCAAAAGGTAGTTTAGCTGGAGTAGATGGACGTATTCAATCACGA
AGTTATGACAATAACGAGGGGCAACGTGTTTTTGTGACGGAAGTTGTAGCAGATAATGTTCAATTTCTAGATAGTGGAAA
TAAAAACAACAATAACCAAAACGGTGGCTATCAGCAAAATAACAACTACCAACAAAATAATGGTTATCAACCCAATAATA
ATTACCAACCAACTCAACAGAACAATAGCTATCAACCACCGCAGCAAAATCAAAATAACTATCAACCACCACAACAACAG
AATACAAGTTATCAACCACCGCAACAAAATCAACAACAAAACCCATTCGCTAACGCTAATGGTCCGATAGATATTCAAGA
TGAGGATTTACCCTTCTAG
ATGATAAACAGAGCAGTTTTAGTAGGTAGATTAACAAAGGATCCGGAATTTAGACAAACAGCAAGTGGGGTAAGTGTAAC
CACATTTACATTAGCAGTAAATAGAACATTCAAAAATAAAAACGGCGAAAGAGAAGCAGATTTTATCAATATAGTTGTAT
TTAGACAACAAGCAGAAAACGTTAATAATTATCTTTCAAAAGGTAGTTTAGCTGGAGTAGATGGACGTATTCAATCACGA
AGTTATGACAATAACGAGGGGCAACGTGTTTTTGTGACGGAAGTTGTAGCAGATAATGTTCAATTTCTAGATAGTGGAAA
TAAAAACAACAATAACCAAAACGGTGGCTATCAGCAAAATAACAACTACCAACAAAATAATGGTTATCAACCCAATAATA
ATTACCAACCAACTCAACAGAACAATAGCTATCAACCACCGCAGCAAAATCAAAATAACTATCAACCACCACAACAACAG
AATACAAGTTATCAACCACCGCAACAAAATCAACAACAAAACCCATTCGCTAACGCTAATGGTCCGATAGATATTCAAGA
TGAGGATTTACCCTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.125 |
100 |
0.531 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.479 |
100 |
0.495 |