Detailed information
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | MNU40_RS03245 | Genome accession | NZ_CP093181 |
| Coordinates | 660777..661352 (+) | Length | 191 a.a. |
| NCBI ID | WP_001829272.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain TMDU-265 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 661753..703860 | 660777..661352 | flank | 401 |
Gene organization within MGE regions
Location: 660777..703860
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNU40_RS03245 (MNU40_03250) | comK/comK1 | 660777..661352 (+) | 576 | WP_001829272.1 | competence protein ComK | Regulator |
| MNU40_RS03260 (MNU40_03265) | - | 661753..662802 (-) | 1050 | WP_001830299.1 | site-specific integrase | - |
| MNU40_RS03265 (MNU40_03270) | - | 662865..663416 (-) | 552 | WP_103422871.1 | Ltp family lipoprotein | - |
| MNU40_RS03270 (MNU40_03275) | - | 663601..664758 (-) | 1158 | WP_164493043.1 | CapA family protein | - |
| MNU40_RS03275 (MNU40_03280) | - | 664762..664929 (-) | 168 | WP_002497581.1 | hypothetical protein | - |
| MNU40_RS03280 (MNU40_03285) | - | 665098..665559 (-) | 462 | WP_002484735.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MNU40_RS03285 (MNU40_03290) | - | 665572..665901 (-) | 330 | WP_002484747.1 | helix-turn-helix domain-containing protein | - |
| MNU40_RS03290 (MNU40_03295) | - | 666095..666334 (+) | 240 | WP_194086740.1 | helix-turn-helix transcriptional regulator | - |
| MNU40_RS03295 (MNU40_03300) | - | 666348..667064 (+) | 717 | WP_002468739.1 | phage repressor protein | - |
| MNU40_RS03300 (MNU40_03305) | - | 667077..667286 (+) | 210 | WP_001830281.1 | hypothetical protein | - |
| MNU40_RS03305 (MNU40_03310) | - | 667413..667679 (-) | 267 | WP_002456364.1 | hypothetical protein | - |
| MNU40_RS03310 (MNU40_03315) | - | 668012..669964 (+) | 1953 | WP_194086741.1 | AAA family ATPase | - |
| MNU40_RS03315 (MNU40_03320) | - | 669966..670889 (+) | 924 | WP_059223500.1 | recombinase RecT | - |
| MNU40_RS03320 (MNU40_03325) | - | 670970..671587 (+) | 618 | WP_254104909.1 | MBL fold metallo-hydrolase | - |
| MNU40_RS03325 (MNU40_03330) | ssbA | 671588..672061 (+) | 474 | WP_059223501.1 | single-stranded DNA-binding protein | Machinery gene |
| MNU40_RS03330 (MNU40_03335) | - | 672091..672978 (+) | 888 | WP_059223502.1 | DnaD domain-containing protein | - |
| MNU40_RS03335 (MNU40_03340) | - | 673018..673425 (+) | 408 | WP_059223503.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MNU40_RS03340 (MNU40_03345) | - | 673426..673632 (+) | 207 | WP_059223504.1 | hypothetical protein | - |
| MNU40_RS03345 (MNU40_03350) | - | 673642..673959 (-) | 318 | WP_228064100.1 | hypothetical protein | - |
| MNU40_RS03350 (MNU40_03355) | dut | 674016..674438 (+) | 423 | WP_252918107.1 | dUTP diphosphatase | - |
| MNU40_RS03355 (MNU40_03360) | - | 674534..674836 (-) | 303 | WP_059223506.1 | DUF4870 domain-containing protein | - |
| MNU40_RS03360 (MNU40_03365) | - | 674941..675108 (+) | 168 | WP_059223507.1 | regulator | - |
| MNU40_RS03365 (MNU40_03370) | - | 675108..675257 (+) | 150 | WP_002484731.1 | DUF1514 family protein | - |
| MNU40_RS03370 (MNU40_03375) | - | 675274..675720 (+) | 447 | WP_059223508.1 | transcriptional regulator | - |
| MNU40_RS03375 (MNU40_03380) | - | 676316..676666 (+) | 351 | WP_083315469.1 | HNH endonuclease signature motif containing protein | - |
| MNU40_RS03380 (MNU40_03385) | - | 676809..677279 (+) | 471 | WP_002484733.1 | phage terminase small subunit P27 family | - |
| MNU40_RS03385 (MNU40_03390) | - | 677272..679023 (+) | 1752 | WP_194086743.1 | terminase TerL endonuclease subunit | - |
| MNU40_RS03390 (MNU40_03395) | - | 679035..679229 (+) | 195 | WP_002500102.1 | hypothetical protein | - |
| MNU40_RS03395 (MNU40_03400) | - | 679232..680464 (+) | 1233 | WP_059223510.1 | phage portal protein | - |
| MNU40_RS03400 (MNU40_03405) | - | 680454..681011 (+) | 558 | WP_059223511.1 | HK97 family phage prohead protease | - |
| MNU40_RS03405 (MNU40_03410) | - | 681051..682409 (+) | 1359 | WP_059223512.1 | phage major capsid protein | - |
| MNU40_RS03410 (MNU40_03415) | - | 682428..682769 (+) | 342 | WP_070840824.1 | head-tail connector protein | - |
| MNU40_RS03415 (MNU40_03420) | - | 682759..683088 (+) | 330 | WP_100481683.1 | head-tail adaptor protein | - |
| MNU40_RS03420 (MNU40_03425) | - | 683223..683489 (+) | 267 | WP_080356004.1 | hypothetical protein | - |
| MNU40_RS03425 (MNU40_03430) | - | 683492..683896 (+) | 405 | WP_100481682.1 | hypothetical protein | - |
| MNU40_RS03430 (MNU40_03435) | - | 683909..684538 (+) | 630 | WP_059223516.1 | major tail protein | - |
| MNU40_RS03435 (MNU40_03440) | - | 684557..684742 (+) | 186 | WP_002503473.1 | hypothetical protein | - |
| MNU40_RS03440 (MNU40_03445) | - | 684806..685165 (+) | 360 | WP_059223517.1 | hypothetical protein | - |
| MNU40_RS03445 (MNU40_03450) | - | 685181..685696 (+) | 516 | WP_059223518.1 | hypothetical protein | - |
| MNU40_RS03450 (MNU40_03455) | - | 685725..690437 (+) | 4713 | WP_254104851.1 | phage tail tape measure protein | - |
| MNU40_RS03455 (MNU40_03460) | - | 690439..691272 (+) | 834 | WP_059223520.1 | phage tail domain-containing protein | - |
| MNU40_RS03460 (MNU40_03465) | - | 691282..692841 (+) | 1560 | WP_254105925.1 | prophage endopeptidase tail family protein | - |
| MNU40_RS03465 (MNU40_03470) | - | 692834..693007 (+) | 174 | WP_254104856.1 | hypothetical protein | - |
| MNU40_RS03470 (MNU40_03475) | - | 693023..694885 (+) | 1863 | WP_254104859.1 | M14 family metallopeptidase | - |
| MNU40_RS03475 (MNU40_03480) | - | 694885..696099 (+) | 1215 | WP_254104861.1 | BppU family phage baseplate upper protein | - |
| MNU40_RS03480 (MNU40_03485) | - | 696104..696727 (+) | 624 | WP_059223933.1 | poly-gamma-glutamate hydrolase family protein | - |
| MNU40_RS03485 (MNU40_03490) | - | 696724..697149 (+) | 426 | WP_002456415.1 | hypothetical protein | - |
| MNU40_RS03490 (MNU40_03495) | - | 697136..697543 (+) | 408 | WP_059223927.1 | hypothetical protein | - |
| MNU40_RS03495 (MNU40_03500) | - | 697701..698099 (+) | 399 | WP_254104863.1 | YxeA family protein | - |
| MNU40_RS03500 (MNU40_03505) | - | 698163..698573 (+) | 411 | WP_254104865.1 | phage holin | - |
| MNU40_RS03505 (MNU40_03510) | - | 698548..700011 (+) | 1464 | WP_254104868.1 | SH3 domain-containing protein | - |
| MNU40_RS03510 (MNU40_03515) | - | 700498..701415 (+) | 918 | WP_194086752.1 | ParA family protein | - |
| MNU40_RS03515 (MNU40_03520) | - | 701384..701749 (+) | 366 | WP_194086753.1 | hypothetical protein | - |
| MNU40_RS03520 (MNU40_03525) | - | 701757..702416 (+) | 660 | WP_194086754.1 | hypothetical protein | - |
| MNU40_RS03525 (MNU40_03530) | - | 702719..703860 (+) | 1142 | WP_254104874.1 | IS3 family transposase | - |
Sequence
Protein
Download Length: 191 a.a. Molecular weight: 22782.87 Da Isoelectric Point: 9.2887
>NTDB_id=662206 MNU40_RS03245 WP_001829272.1 660777..661352(+) (comK/comK1) [Staphylococcus epidermidis strain TMDU-265]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
Nucleotide
Download Length: 576 bp
>NTDB_id=662206 MNU40_RS03245 WP_001829272.1 660777..661352(+) (comK/comK1) [Staphylococcus epidermidis strain TMDU-265]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
76.757 |
96.859 |
0.743 |
| comK/comK1 | Staphylococcus aureus N315 |
76.757 |
96.859 |
0.743 |