Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   MNU40_RS03245 Genome accession   NZ_CP093181
Coordinates   660777..661352 (+) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain TMDU-265     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 661753..703860 660777..661352 flank 401


Gene organization within MGE regions


Location: 660777..703860
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNU40_RS03245 (MNU40_03250) comK/comK1 660777..661352 (+) 576 WP_001829272.1 competence protein ComK Regulator
  MNU40_RS03260 (MNU40_03265) - 661753..662802 (-) 1050 WP_001830299.1 site-specific integrase -
  MNU40_RS03265 (MNU40_03270) - 662865..663416 (-) 552 WP_103422871.1 Ltp family lipoprotein -
  MNU40_RS03270 (MNU40_03275) - 663601..664758 (-) 1158 WP_164493043.1 CapA family protein -
  MNU40_RS03275 (MNU40_03280) - 664762..664929 (-) 168 WP_002497581.1 hypothetical protein -
  MNU40_RS03280 (MNU40_03285) - 665098..665559 (-) 462 WP_002484735.1 ImmA/IrrE family metallo-endopeptidase -
  MNU40_RS03285 (MNU40_03290) - 665572..665901 (-) 330 WP_002484747.1 helix-turn-helix domain-containing protein -
  MNU40_RS03290 (MNU40_03295) - 666095..666334 (+) 240 WP_194086740.1 helix-turn-helix transcriptional regulator -
  MNU40_RS03295 (MNU40_03300) - 666348..667064 (+) 717 WP_002468739.1 phage repressor protein -
  MNU40_RS03300 (MNU40_03305) - 667077..667286 (+) 210 WP_001830281.1 hypothetical protein -
  MNU40_RS03305 (MNU40_03310) - 667413..667679 (-) 267 WP_002456364.1 hypothetical protein -
  MNU40_RS03310 (MNU40_03315) - 668012..669964 (+) 1953 WP_194086741.1 AAA family ATPase -
  MNU40_RS03315 (MNU40_03320) - 669966..670889 (+) 924 WP_059223500.1 recombinase RecT -
  MNU40_RS03320 (MNU40_03325) - 670970..671587 (+) 618 WP_254104909.1 MBL fold metallo-hydrolase -
  MNU40_RS03325 (MNU40_03330) ssbA 671588..672061 (+) 474 WP_059223501.1 single-stranded DNA-binding protein Machinery gene
  MNU40_RS03330 (MNU40_03335) - 672091..672978 (+) 888 WP_059223502.1 DnaD domain-containing protein -
  MNU40_RS03335 (MNU40_03340) - 673018..673425 (+) 408 WP_059223503.1 RusA family crossover junction endodeoxyribonuclease -
  MNU40_RS03340 (MNU40_03345) - 673426..673632 (+) 207 WP_059223504.1 hypothetical protein -
  MNU40_RS03345 (MNU40_03350) - 673642..673959 (-) 318 WP_228064100.1 hypothetical protein -
  MNU40_RS03350 (MNU40_03355) dut 674016..674438 (+) 423 WP_252918107.1 dUTP diphosphatase -
  MNU40_RS03355 (MNU40_03360) - 674534..674836 (-) 303 WP_059223506.1 DUF4870 domain-containing protein -
  MNU40_RS03360 (MNU40_03365) - 674941..675108 (+) 168 WP_059223507.1 regulator -
  MNU40_RS03365 (MNU40_03370) - 675108..675257 (+) 150 WP_002484731.1 DUF1514 family protein -
  MNU40_RS03370 (MNU40_03375) - 675274..675720 (+) 447 WP_059223508.1 transcriptional regulator -
  MNU40_RS03375 (MNU40_03380) - 676316..676666 (+) 351 WP_083315469.1 HNH endonuclease signature motif containing protein -
  MNU40_RS03380 (MNU40_03385) - 676809..677279 (+) 471 WP_002484733.1 phage terminase small subunit P27 family -
  MNU40_RS03385 (MNU40_03390) - 677272..679023 (+) 1752 WP_194086743.1 terminase TerL endonuclease subunit -
  MNU40_RS03390 (MNU40_03395) - 679035..679229 (+) 195 WP_002500102.1 hypothetical protein -
  MNU40_RS03395 (MNU40_03400) - 679232..680464 (+) 1233 WP_059223510.1 phage portal protein -
  MNU40_RS03400 (MNU40_03405) - 680454..681011 (+) 558 WP_059223511.1 HK97 family phage prohead protease -
  MNU40_RS03405 (MNU40_03410) - 681051..682409 (+) 1359 WP_059223512.1 phage major capsid protein -
  MNU40_RS03410 (MNU40_03415) - 682428..682769 (+) 342 WP_070840824.1 head-tail connector protein -
  MNU40_RS03415 (MNU40_03420) - 682759..683088 (+) 330 WP_100481683.1 head-tail adaptor protein -
  MNU40_RS03420 (MNU40_03425) - 683223..683489 (+) 267 WP_080356004.1 hypothetical protein -
  MNU40_RS03425 (MNU40_03430) - 683492..683896 (+) 405 WP_100481682.1 hypothetical protein -
  MNU40_RS03430 (MNU40_03435) - 683909..684538 (+) 630 WP_059223516.1 major tail protein -
  MNU40_RS03435 (MNU40_03440) - 684557..684742 (+) 186 WP_002503473.1 hypothetical protein -
  MNU40_RS03440 (MNU40_03445) - 684806..685165 (+) 360 WP_059223517.1 hypothetical protein -
  MNU40_RS03445 (MNU40_03450) - 685181..685696 (+) 516 WP_059223518.1 hypothetical protein -
  MNU40_RS03450 (MNU40_03455) - 685725..690437 (+) 4713 WP_254104851.1 phage tail tape measure protein -
  MNU40_RS03455 (MNU40_03460) - 690439..691272 (+) 834 WP_059223520.1 phage tail domain-containing protein -
  MNU40_RS03460 (MNU40_03465) - 691282..692841 (+) 1560 WP_254105925.1 prophage endopeptidase tail family protein -
  MNU40_RS03465 (MNU40_03470) - 692834..693007 (+) 174 WP_254104856.1 hypothetical protein -
  MNU40_RS03470 (MNU40_03475) - 693023..694885 (+) 1863 WP_254104859.1 M14 family metallopeptidase -
  MNU40_RS03475 (MNU40_03480) - 694885..696099 (+) 1215 WP_254104861.1 BppU family phage baseplate upper protein -
  MNU40_RS03480 (MNU40_03485) - 696104..696727 (+) 624 WP_059223933.1 poly-gamma-glutamate hydrolase family protein -
  MNU40_RS03485 (MNU40_03490) - 696724..697149 (+) 426 WP_002456415.1 hypothetical protein -
  MNU40_RS03490 (MNU40_03495) - 697136..697543 (+) 408 WP_059223927.1 hypothetical protein -
  MNU40_RS03495 (MNU40_03500) - 697701..698099 (+) 399 WP_254104863.1 YxeA family protein -
  MNU40_RS03500 (MNU40_03505) - 698163..698573 (+) 411 WP_254104865.1 phage holin -
  MNU40_RS03505 (MNU40_03510) - 698548..700011 (+) 1464 WP_254104868.1 SH3 domain-containing protein -
  MNU40_RS03510 (MNU40_03515) - 700498..701415 (+) 918 WP_194086752.1 ParA family protein -
  MNU40_RS03515 (MNU40_03520) - 701384..701749 (+) 366 WP_194086753.1 hypothetical protein -
  MNU40_RS03520 (MNU40_03525) - 701757..702416 (+) 660 WP_194086754.1 hypothetical protein -
  MNU40_RS03525 (MNU40_03530) - 702719..703860 (+) 1142 WP_254104874.1 IS3 family transposase -

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=662206 MNU40_RS03245 WP_001829272.1 660777..661352(+) (comK/comK1) [Staphylococcus epidermidis strain TMDU-265]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=662206 MNU40_RS03245 WP_001829272.1 660777..661352(+) (comK/comK1) [Staphylococcus epidermidis strain TMDU-265]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains


Predicted by InterproScan.

(7-158)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743

  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743