Detailed information
Bioinformatically predicted
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | MNU31_RS03510 | Genome accession | NZ_CP093179 |
| Coordinates | 714556..715131 (+) | Length | 191 a.a. |
| NCBI ID | WP_001829272.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain TMDU-190 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 715532..757639 | 714556..715131 | flank | 401 |
Gene organization within MGE regions
Location: 714556..757639
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNU31_RS03510 (MNU31_03515) | comK/comK1 | 714556..715131 (+) | 576 | WP_001829272.1 | competence protein ComK | Regulator |
| MNU31_RS03525 (MNU31_03530) | - | 715532..716581 (-) | 1050 | WP_001830299.1 | site-specific integrase | - |
| MNU31_RS03530 (MNU31_03535) | - | 716644..717195 (-) | 552 | WP_103422871.1 | Ltp family lipoprotein | - |
| MNU31_RS03535 (MNU31_03540) | - | 717380..718537 (-) | 1158 | WP_164493043.1 | CapA family protein | - |
| MNU31_RS03540 (MNU31_03545) | - | 718541..718708 (-) | 168 | WP_002497581.1 | hypothetical protein | - |
| MNU31_RS03545 (MNU31_03550) | - | 718877..719338 (-) | 462 | WP_002484735.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MNU31_RS03550 (MNU31_03555) | - | 719351..719680 (-) | 330 | WP_002484747.1 | helix-turn-helix domain-containing protein | - |
| MNU31_RS03555 (MNU31_03560) | - | 719874..720113 (+) | 240 | WP_194086740.1 | helix-turn-helix transcriptional regulator | - |
| MNU31_RS03560 (MNU31_03565) | - | 720127..720843 (+) | 717 | WP_002468739.1 | phage repressor protein | - |
| MNU31_RS03565 (MNU31_03570) | - | 720856..721065 (+) | 210 | WP_001830281.1 | hypothetical protein | - |
| MNU31_RS03570 (MNU31_03575) | - | 721192..721458 (-) | 267 | WP_002456364.1 | hypothetical protein | - |
| MNU31_RS03575 (MNU31_03580) | - | 721791..723743 (+) | 1953 | WP_254104848.1 | AAA family ATPase | - |
| MNU31_RS03580 (MNU31_03585) | - | 723745..724668 (+) | 924 | WP_059223500.1 | recombinase RecT | - |
| MNU31_RS03585 (MNU31_03590) | - | 724749..725366 (+) | 618 | WP_254104909.1 | MBL fold metallo-hydrolase | - |
| MNU31_RS03590 (MNU31_03595) | ssbA | 725367..725840 (+) | 474 | WP_059223501.1 | single-stranded DNA-binding protein | Machinery gene |
| MNU31_RS03595 (MNU31_03600) | - | 725870..726757 (+) | 888 | WP_059223502.1 | DnaD domain-containing protein | - |
| MNU31_RS03600 (MNU31_03605) | - | 726797..727204 (+) | 408 | WP_059223503.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MNU31_RS03605 (MNU31_03610) | - | 727205..727411 (+) | 207 | WP_059223504.1 | hypothetical protein | - |
| MNU31_RS03610 (MNU31_03615) | - | 727421..727738 (-) | 318 | WP_228064100.1 | hypothetical protein | - |
| MNU31_RS03615 (MNU31_03620) | dut | 727795..728217 (+) | 423 | WP_252918107.1 | dUTP diphosphatase | - |
| MNU31_RS03620 (MNU31_03625) | - | 728313..728615 (-) | 303 | WP_059223506.1 | DUF4870 domain-containing protein | - |
| MNU31_RS03625 (MNU31_03630) | - | 728720..728887 (+) | 168 | WP_059223507.1 | regulator | - |
| MNU31_RS03630 (MNU31_03635) | - | 728887..729036 (+) | 150 | WP_002484731.1 | DUF1514 family protein | - |
| MNU31_RS03635 (MNU31_03640) | - | 729053..729499 (+) | 447 | WP_059223508.1 | transcriptional regulator | - |
| MNU31_RS03640 (MNU31_03645) | - | 730095..730445 (+) | 351 | WP_083315469.1 | HNH endonuclease signature motif containing protein | - |
| MNU31_RS03645 (MNU31_03650) | - | 730588..731058 (+) | 471 | WP_002484733.1 | phage terminase small subunit P27 family | - |
| MNU31_RS03650 (MNU31_03655) | - | 731051..732802 (+) | 1752 | WP_194086743.1 | terminase TerL endonuclease subunit | - |
| MNU31_RS03655 (MNU31_03660) | - | 732814..733008 (+) | 195 | WP_002500102.1 | hypothetical protein | - |
| MNU31_RS03660 (MNU31_03665) | - | 733011..734243 (+) | 1233 | WP_059223510.1 | phage portal protein | - |
| MNU31_RS03665 (MNU31_03670) | - | 734233..734790 (+) | 558 | WP_059223511.1 | HK97 family phage prohead protease | - |
| MNU31_RS03670 (MNU31_03675) | - | 734830..736188 (+) | 1359 | WP_059223512.1 | phage major capsid protein | - |
| MNU31_RS03675 (MNU31_03680) | - | 736207..736548 (+) | 342 | WP_070840824.1 | head-tail connector protein | - |
| MNU31_RS03680 (MNU31_03685) | - | 736538..736867 (+) | 330 | WP_100481683.1 | head-tail adaptor protein | - |
| MNU31_RS03685 (MNU31_03690) | - | 737002..737268 (+) | 267 | WP_080356004.1 | hypothetical protein | - |
| MNU31_RS03690 (MNU31_03695) | - | 737271..737675 (+) | 405 | WP_100481682.1 | hypothetical protein | - |
| MNU31_RS03695 (MNU31_03700) | - | 737688..738317 (+) | 630 | WP_059223516.1 | major tail protein | - |
| MNU31_RS03700 (MNU31_03705) | - | 738336..738521 (+) | 186 | WP_002503473.1 | hypothetical protein | - |
| MNU31_RS03705 (MNU31_03710) | - | 738585..738944 (+) | 360 | WP_059223517.1 | hypothetical protein | - |
| MNU31_RS03710 (MNU31_03715) | - | 738960..739475 (+) | 516 | WP_059223518.1 | hypothetical protein | - |
| MNU31_RS03715 (MNU31_03720) | - | 739504..744216 (+) | 4713 | WP_254104851.1 | phage tail tape measure protein | - |
| MNU31_RS03720 (MNU31_03725) | - | 744218..745051 (+) | 834 | WP_059223520.1 | phage tail domain-containing protein | - |
| MNU31_RS03725 (MNU31_03730) | - | 745061..746620 (+) | 1560 | WP_254104854.1 | prophage endopeptidase tail family protein | - |
| MNU31_RS03730 (MNU31_03735) | - | 746613..746786 (+) | 174 | WP_254104856.1 | hypothetical protein | - |
| MNU31_RS03735 (MNU31_03740) | - | 746802..748664 (+) | 1863 | WP_254104859.1 | M14 family metallopeptidase | - |
| MNU31_RS03740 (MNU31_03745) | - | 748664..749878 (+) | 1215 | WP_254104861.1 | BppU family phage baseplate upper protein | - |
| MNU31_RS03745 (MNU31_03750) | - | 749883..750506 (+) | 624 | WP_059223933.1 | poly-gamma-glutamate hydrolase family protein | - |
| MNU31_RS03750 (MNU31_03755) | - | 750503..750928 (+) | 426 | WP_002456415.1 | hypothetical protein | - |
| MNU31_RS03755 (MNU31_03760) | - | 750915..751322 (+) | 408 | WP_059223927.1 | hypothetical protein | - |
| MNU31_RS03760 (MNU31_03765) | - | 751480..751878 (+) | 399 | WP_254104863.1 | YxeA family protein | - |
| MNU31_RS03765 (MNU31_03770) | - | 751942..752352 (+) | 411 | WP_254104865.1 | phage holin | - |
| MNU31_RS03770 (MNU31_03775) | - | 752327..753790 (+) | 1464 | WP_254104868.1 | SH3 domain-containing protein | - |
| MNU31_RS03775 (MNU31_03780) | - | 754277..755194 (+) | 918 | WP_194086752.1 | ParA family protein | - |
| MNU31_RS03780 (MNU31_03785) | - | 755163..755528 (+) | 366 | WP_194086753.1 | hypothetical protein | - |
| MNU31_RS03785 (MNU31_03790) | - | 755536..756195 (+) | 660 | WP_194086754.1 | hypothetical protein | - |
| MNU31_RS03790 (MNU31_03795) | - | 756498..757639 (+) | 1142 | WP_254104874.1 | IS3 family transposase | - |
Sequence
Protein
Download Length: 191 a.a. Molecular weight: 22782.87 Da Isoelectric Point: 9.2887
>NTDB_id=662170 MNU31_RS03510 WP_001829272.1 714556..715131(+) (comK/comK1) [Staphylococcus epidermidis strain TMDU-190]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
Nucleotide
Download Length: 576 bp
>NTDB_id=662170 MNU31_RS03510 WP_001829272.1 714556..715131(+) (comK/comK1) [Staphylococcus epidermidis strain TMDU-190]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
76.757 |
96.859 |
0.743 |
| comK/comK1 | Staphylococcus aureus N315 |
76.757 |
96.859 |
0.743 |