Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | MLD56_RS02690 | Genome accession | NZ_CP092831 |
| Coordinates | 587938..588363 (+) | Length | 141 a.a. |
| NCBI ID | WP_241113463.1 | Uniprot ID | - |
| Organism | Paenibacillus peoriae strain ZBSF16 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 535258..587683 | 587938..588363 | flank | 255 |
Gene organization within MGE regions
Location: 535258..588363
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MLD56_RS02350 (MLD56_02350) | - | 535258..536289 (-) | 1032 | WP_029517885.1 | ribonucleotide-diphosphate reductase subunit beta | - |
| MLD56_RS02355 (MLD56_02355) | - | 536310..538643 (-) | 2334 | WP_029517884.1 | ribonucleoside-diphosphate reductase subunit alpha | - |
| MLD56_RS02360 (MLD56_02360) | - | 539169..539516 (+) | 348 | WP_029517883.1 | MTH1187 family thiamine-binding protein | - |
| MLD56_RS02370 (MLD56_02370) | - | 539755..540927 (-) | 1173 | WP_029517882.1 | site-specific integrase | - |
| MLD56_RS02375 (MLD56_02375) | - | 541040..541609 (-) | 570 | WP_029517881.1 | hypothetical protein | - |
| MLD56_RS02380 (MLD56_02380) | - | 541972..542340 (-) | 369 | WP_029517880.1 | helix-turn-helix transcriptional regulator | - |
| MLD56_RS02385 (MLD56_02385) | - | 542511..542765 (+) | 255 | WP_049817010.1 | helix-turn-helix transcriptional regulator | - |
| MLD56_RS02390 (MLD56_02390) | - | 542965..543159 (+) | 195 | WP_029517878.1 | hypothetical protein | - |
| MLD56_RS02395 (MLD56_02395) | - | 543295..543810 (+) | 516 | WP_029517877.1 | helix-turn-helix transcriptional regulator | - |
| MLD56_RS02400 (MLD56_02400) | - | 543821..544102 (+) | 282 | WP_029517876.1 | hypothetical protein | - |
| MLD56_RS02405 (MLD56_02405) | - | 544099..544335 (+) | 237 | WP_029517875.1 | hypothetical protein | - |
| MLD56_RS02410 (MLD56_02410) | - | 544579..544830 (+) | 252 | WP_029517874.1 | hypothetical protein | - |
| MLD56_RS02415 (MLD56_02415) | - | 544827..545072 (+) | 246 | WP_029517873.1 | hypothetical protein | - |
| MLD56_RS02420 (MLD56_02420) | - | 545174..546121 (+) | 948 | WP_029517872.1 | lambda-exonuclease family protein | - |
| MLD56_RS02425 (MLD56_02425) | recT | 546132..547025 (+) | 894 | WP_029517871.1 | recombination protein RecT | - |
| MLD56_RS02430 (MLD56_02430) | - | 547022..547225 (+) | 204 | WP_080658635.1 | hypothetical protein | - |
| MLD56_RS02435 (MLD56_02435) | - | 547297..548310 (+) | 1014 | WP_029517870.1 | replication protein | - |
| MLD56_RS02440 (MLD56_02440) | - | 548276..549562 (+) | 1287 | WP_029517869.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| MLD56_RS02445 (MLD56_02445) | - | 549576..549770 (+) | 195 | WP_013372040.1 | hypothetical protein | - |
| MLD56_RS25950 | - | 550119..550253 (+) | 135 | WP_277397972.1 | hypothetical protein | - |
| MLD56_RS02450 (MLD56_02450) | - | 550250..550792 (+) | 543 | WP_049817009.1 | hypothetical protein | - |
| MLD56_RS02455 (MLD56_02455) | - | 550799..551635 (+) | 837 | WP_241113460.1 | hypothetical protein | - |
| MLD56_RS02460 (MLD56_02460) | - | 551714..552016 (-) | 303 | WP_029517865.1 | hypothetical protein | - |
| MLD56_RS02465 (MLD56_02465) | - | 552202..552441 (+) | 240 | WP_029517864.1 | hypothetical protein | - |
| MLD56_RS02470 (MLD56_02470) | - | 552552..553034 (+) | 483 | WP_029517863.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MLD56_RS02475 (MLD56_02475) | mauJ | 553133..553873 (+) | 741 | WP_029517862.1 | methylamine utilization protein MauJ | - |
| MLD56_RS02480 (MLD56_02480) | - | 554025..554540 (+) | 516 | WP_241113461.1 | hypothetical protein | - |
| MLD56_RS02485 (MLD56_02485) | - | 555313..555933 (+) | 621 | WP_029517846.1 | hypothetical protein | - |
| MLD56_RS02490 (MLD56_02490) | - | 556152..556568 (+) | 417 | WP_029517845.1 | hypothetical protein | - |
| MLD56_RS02495 (MLD56_02495) | - | 556584..556742 (-) | 159 | WP_161627005.1 | hypothetical protein | - |
| MLD56_RS02500 (MLD56_02500) | - | 556981..558285 (+) | 1305 | WP_029517844.1 | site-specific DNA-methyltransferase | - |
| MLD56_RS02505 (MLD56_02505) | - | 558424..558642 (+) | 219 | WP_013372024.1 | hypothetical protein | - |
| MLD56_RS02510 (MLD56_02510) | - | 558788..559288 (+) | 501 | WP_029517843.1 | hypothetical protein | - |
| MLD56_RS02515 (MLD56_02515) | - | 559355..560239 (+) | 885 | WP_029517842.1 | phage terminase small subunit-related protein | - |
| MLD56_RS02520 (MLD56_02520) | - | 560233..561921 (+) | 1689 | WP_029517841.1 | DNA packaging protein | - |
| MLD56_RS02525 (MLD56_02525) | - | 561925..563421 (+) | 1497 | WP_029517840.1 | phage portal protein | - |
| MLD56_RS02530 (MLD56_02530) | - | 563414..564244 (+) | 831 | WP_029517839.1 | phage minor head protein | - |
| MLD56_RS02535 (MLD56_02535) | - | 564269..565507 (+) | 1239 | WP_029517838.1 | XkdF-like putative serine protease domain-containing protein | - |
| MLD56_RS02540 (MLD56_02540) | - | 565532..566464 (+) | 933 | WP_029517837.1 | P2 family phage major capsid protein | - |
| MLD56_RS02545 (MLD56_02545) | - | 566464..566826 (+) | 363 | WP_029517836.1 | Rho termination factor N-terminal domain-containing protein | - |
| MLD56_RS02550 (MLD56_02550) | - | 566795..567178 (+) | 384 | WP_029517835.1 | DUF3199 family protein | - |
| MLD56_RS02555 (MLD56_02555) | - | 567175..567501 (+) | 327 | WP_029517834.1 | hypothetical protein | - |
| MLD56_RS02560 (MLD56_02560) | - | 567488..567982 (+) | 495 | WP_029517833.1 | HK97 gp10 family phage protein | - |
| MLD56_RS02565 (MLD56_02565) | - | 567982..568476 (+) | 495 | WP_029517832.1 | hypothetical protein | - |
| MLD56_RS02570 (MLD56_02570) | - | 568473..568733 (+) | 261 | WP_029517831.1 | hypothetical protein | - |
| MLD56_RS02575 (MLD56_02575) | - | 568714..570066 (+) | 1353 | WP_029517830.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| MLD56_RS02580 (MLD56_02580) | - | 570070..570513 (+) | 444 | WP_029517829.1 | phage tail tube protein | - |
| MLD56_RS02585 (MLD56_02585) | - | 570734..571075 (+) | 342 | WP_029517828.1 | hypothetical protein | - |
| MLD56_RS02590 (MLD56_02590) | - | 571205..571615 (+) | 411 | WP_029517827.1 | hypothetical protein | - |
| MLD56_RS02595 (MLD56_02595) | - | 571858..575310 (+) | 3453 | WP_241113462.1 | tail tape measure protein | - |
| MLD56_RS02600 (MLD56_02600) | - | 575314..575961 (+) | 648 | WP_029517824.1 | hypothetical protein | - |
| MLD56_RS02605 (MLD56_02605) | - | 575968..576945 (+) | 978 | WP_029517823.1 | hypothetical protein | - |
| MLD56_RS02610 (MLD56_02610) | - | 576948..577373 (+) | 426 | WP_029517822.1 | hypothetical protein | - |
| MLD56_RS02615 (MLD56_02615) | - | 577366..577809 (+) | 444 | WP_080658634.1 | DUF2634 domain-containing protein | - |
| MLD56_RS02620 (MLD56_02620) | - | 577806..578630 (+) | 825 | WP_029517820.1 | baseplate J/gp47 family protein | - |
| MLD56_RS02625 (MLD56_02625) | - | 578627..579379 (+) | 753 | WP_029517819.1 | putative phage tail protein | - |
| MLD56_RS02630 (MLD56_02630) | - | 579394..579783 (+) | 390 | WP_029517818.1 | phage tail protein | - |
| MLD56_RS02635 (MLD56_02635) | - | 579801..580958 (+) | 1158 | WP_029517817.1 | phage tail protein | - |
| MLD56_RS02640 (MLD56_02640) | - | 581027..581365 (+) | 339 | WP_152526727.1 | hypothetical protein | - |
| MLD56_RS02645 (MLD56_02645) | - | 581424..581615 (+) | 192 | WP_029517815.1 | CD1375 family protein | - |
| MLD56_RS02650 (MLD56_02650) | - | 581694..582191 (+) | 498 | WP_029517814.1 | phage holin family protein | - |
| MLD56_RS02655 (MLD56_02655) | - | 582139..582909 (+) | 771 | WP_049817005.1 | M15 family metallopeptidase | - |
| MLD56_RS02660 (MLD56_02660) | - | 582909..583127 (+) | 219 | WP_029517812.1 | hypothetical protein | - |
| MLD56_RS02665 (MLD56_02665) | - | 583271..583846 (+) | 576 | WP_049817004.1 | sce7726 family protein | - |
| MLD56_RS02670 (MLD56_02670) | - | 583815..584894 (-) | 1080 | WP_029517810.1 | beta family protein | - |
| MLD56_RS02675 (MLD56_02675) | - | 585384..586796 (+) | 1413 | WP_029517809.1 | hypothetical protein | - |
| MLD56_RS02680 (MLD56_02680) | - | 586984..587214 (+) | 231 | WP_029517808.1 | hypothetical protein | - |
| MLD56_RS02685 (MLD56_02685) | - | 587264..587683 (+) | 420 | WP_029517807.1 | hypothetical protein | - |
| MLD56_RS02690 (MLD56_02690) | nucA/comI | 587938..588363 (+) | 426 | WP_241113463.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15349.31 Da Isoelectric Point: 7.2407
>NTDB_id=660655 MLD56_RS02690 WP_241113463.1 587938..588363(+) (nucA/comI) [Paenibacillus peoriae strain ZBSF16]
MIKGIVRGLIVFFLAAIFSVQGVYAEPTAISQQAAGYTLEFPSSRYPETGAHIRDAIAAGHSAVCTIDRDGAEENRKESL
KGYPTKKGYDRDEWPMAMCAEGGAGADIRYITPSDNRGAGSWVSHQLDKYSDGTKVRFIVK
MIKGIVRGLIVFFLAAIFSVQGVYAEPTAISQQAAGYTLEFPSSRYPETGAHIRDAIAAGHSAVCTIDRDGAEENRKESL
KGYPTKKGYDRDEWPMAMCAEGGAGADIRYITPSDNRGAGSWVSHQLDKYSDGTKVRFIVK
Nucleotide
Download Length: 426 bp
>NTDB_id=660655 MLD56_RS02690 WP_241113463.1 587938..588363(+) (nucA/comI) [Paenibacillus peoriae strain ZBSF16]
ATGATAAAAGGAATCGTAAGAGGATTAATTGTATTTTTTCTGGCTGCTATTTTCTCGGTACAAGGCGTTTATGCTGAACC
AACAGCAATCAGTCAACAGGCAGCTGGGTATACGTTGGAGTTCCCAAGTTCACGTTACCCTGAAACTGGGGCGCACATTA
GAGATGCAATAGCAGCTGGACATTCTGCTGTATGTACCATTGATCGGGATGGGGCAGAGGAGAATAGAAAGGAATCTTTA
AAGGGTTATCCGACTAAAAAAGGATATGACCGAGATGAATGGCCAATGGCAATGTGTGCTGAAGGGGGCGCAGGTGCTGA
TATTCGATACATAACCCCTAGTGATAACCGGGGAGCAGGATCATGGGTAAGCCATCAGTTAGATAAATATTCTGATGGCA
CAAAGGTAAGATTCATAGTGAAATAA
ATGATAAAAGGAATCGTAAGAGGATTAATTGTATTTTTTCTGGCTGCTATTTTCTCGGTACAAGGCGTTTATGCTGAACC
AACAGCAATCAGTCAACAGGCAGCTGGGTATACGTTGGAGTTCCCAAGTTCACGTTACCCTGAAACTGGGGCGCACATTA
GAGATGCAATAGCAGCTGGACATTCTGCTGTATGTACCATTGATCGGGATGGGGCAGAGGAGAATAGAAAGGAATCTTTA
AAGGGTTATCCGACTAAAAAAGGATATGACCGAGATGAATGGCCAATGGCAATGTGTGCTGAAGGGGGCGCAGGTGCTGA
TATTCGATACATAACCCCTAGTGATAACCGGGGAGCAGGATCATGGGTAAGCCATCAGTTAGATAAATATTCTGATGGCA
CAAAGGTAAGATTCATAGTGAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
70.192 |
73.759 |
0.518 |